SecReT4
Protein ID: 9507644
T4SS name [ID]Tra_F [114]
Gene symboltraH
Locus tagD742_p2071
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]69777..71159 [+]
Producthypothetical protein
Component typeTraH_F
UniProt IDQ9WTB4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 3.1e-118, Aligned region: 32..381
Protein Sequence: 460 a.a.     [Download]
>gi|9507644|ref|NP_052975.1| traH [Shigella flexneri 2b]
MAIMLRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQV
KNIQLISMTLPDINAGCGGIDAYLGSFSFINGDQLQRFVKQIMSNAAGYFFDLALQATVPEIKTAKDFLQ
KMASDINSMNLSSCQVAQGIVGGLFPQTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSSSVRDKAS
DKDKERVLKNINIIWDSLSKNRMLDGNKELKEFIMTLTGTLIFGEDSEITPLPARTTDRDILRAIMEGGT
AKVYHCNDSDKCLKVVADANVTIARDKALKSQITKLLTSIQNKAVSDTPLDDREKGFISSTTVPVFKYLI
DPQMLGVSSSVVYQLTDYIGYDIMLQYIQELLQQARAMIATGNYPQTVLDSVLENLNQAQQQIAVFQGQV
KVQQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|9507549|ref|NC_002134.1|:69777-71159 Shigella flexneri 2b plasmid R100 DNA, complete sequence
GTGGCAATAATGCTTCGCATTAAACCTCTTCTGGTTCTTTGTGCCGCTTTACTGACGGTCACACCCGCAG
CGTCAGCGGATGTGAACAGCGACATGAATCAGTTCTTTAATAAGCTGGGATTTGCTTCCAATACCACACA
ACCGGGCGTCTGGCAGGGGCAGGCCGCCGGGTATGCCTATGGTGGCTCCCTGTATGCCCGCACCCAGGTC
AAAAATATCCAGCTGATTTCCATGACGCTGCCGGATATCAATGCCGGATGTGGCGGCATCGACGCCTATC
TCGGCTCGTTCAGTTTTATTAATGGCGATCAGTTGCAGCGTTTTGTTAAGCAGATTATGAGCAACGCTGC
CGGTTACTTTTTTGACCTTGCCCTGCAGGCAACGGTGCCGGAAATCAAAACCGCAAAAGACTTCCTGCAG
AAAATGGCAAGCGACATTAACAGTATGAACCTCAGCTCCTGTCAGGTGGCGCAGGGGATTGTCGGAGGAT
TATTTCCTCAGACTCAGGTGTCACAGCAGAAGGTCTGTCAGGACATTGCCGGTGAGAGCAATATTTTTGC
TGACTGGGCCGCGTCCCGTCAGGGCTGCACGGTCGGAGGACAGTCATCGTCTGTTCGTGACAAGGCCAGT
GACAAAGATAAGGAACGGGTGCTGAAGAACATCAATATCATCTGGGACTCGCTGTCCAAAAACAGGATGC
TTGATGGTAACAAAGAACTGAAAGAATTTATTATGACGCTCACCGGTACGCTGATTTTTGGGGAAGACAG
CGAGATTACCCCCCTGCCGGCGCGTACCACTGACCGCGATATCCTCCGGGCGATTATGGAGGGGGGAACG
GCAAAAGTTTATCACTGCAACGATTCGGACAAGTGTCTGAAGGTGGTGGCGGATGCAAATGTGACCATCG
CCCGGGATAAAGCCCTGAAATCACAGATTACAAAACTGCTCACCAGTATTCAGAATAAAGCGGTGAGTGA
TACTCCACTGGATGACAGGGAAAAAGGCTTCATTTCCAGCACCACCGTCCCCGTCTTTAAATATCTTATT
GACCCGCAGATGCTCGGTGTATCCAGCAGCGTGGTTTACCAGCTGACGGACTATATCGGCTACGACATCA
TGCTCCAGTACATTCAGGAACTGCTTCAGCAGGCCCGGGCCATGATTGCCACCGGGAACTATCCACAGAC
CGTGCTGGACAGTGTGCTGGAGAATCTGAATCAGGCACAGCAACAGATTGCGGTTTTCCAGGGGCAGGTA
AAGGTCCAGCAGGATGCATTGCTGGTTGTTGACCGTCAGATGAGCTATATGCGCCAGCAGCTTTCCGCCC
GCATGCTCAGCCGTTACCAGAACAACTATCACTTCGGAGGGAGCACGCTGTGA
 Primer design