SecReT4
Protein ID: 9507645
T4SS name [ID]Tra_F [114]
Gene symboltraG
Locus tagD742_p2072
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]71156..73978 [+]
Producthypothetical protein
Component typeTraG_F
UniProt IDQ7AK64
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.9e-123, Aligned region: 3..450
Protein Sequence: 940 a.a.     [Download]
>gi|9507645|ref|NP_052976.1| traG [Shigella flexneri 2b]
MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVQVHRVDNVPVGLAMPLSLTTRIGHAMVASYEMIFTQPDSATYSKTGMLFGANLI
VKSTDFLSRNPEIINLFQDYVQNCVLGDIYLNHKYTLEDLMASADPYTLIFSRPSPLRGVYDSNNNFITC
KDASVTLKDRLNLDTKTGGKTWHYYVQQIFGGRPDPDLLFRQLVSDSYSYFYGSSQSASHIMRQNVTMNA
LKEGITSNAARNGDTASLVSLATTSSMEKQRLAHVSIGHVLMRNLPMVQTILVGITIGIFPLLVLAAVFN
RLTLSVLRGYVFALMWFQTWPLLYAILNSAMTFYAKQNGAPVVLSELSQIQLKYSDLASTAGYISVMIPP
LSWMMVKGLGAGFSSVYSHFASSAISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQT
GSGATATQTRDGNMVMDASGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNSLSQ
FGSNRGSSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASRSTRASAGMYGDAHAE
WGVKPKILGVGGGLGVRGGGRAGIDWEDNDAHTASSNTQSSHNARHDIDARATQDFKEASDYFTSRKVSE
SGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEDLSQQFAQYVMKHA
PQDAEAILTNTSSPEIAERRRAMAWSFVQEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGH
QAIIDQRTQDSNIRNDVKHQVDNMVTEYKGNIGDTQNSVRGEENIVRGQYSELQNHHKTEALSQNNKYNE
EKSAQERMPGADSPQELMKRAKEYQDKYKQ
 
Nucleotide Sequence: 2823 bp     [Download]
>gi|9507549|ref|NC_002134.1|:71156-73978 Shigella flexneri 2b plasmid R100 DNA, complete sequence
GTGAATGAAGTCTATGTGATTGCCGGTGGTGAGTGGTTACGCAATAACCTGAACGCCATTGCCGCCTTTA
TGGGGACCCGGACGTGGGATTCCATCGAAAAAATTGCGCTCACATTGTCTGTTCTCGCGGTGGCCGTGAT
GTGGGTACAGCGGCACAACGTGATGGATTTGCTGGGCTGGGTGGCCGTGTTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGTACATCGGTGCAGATTATTGATAACAGTGACCTGGTCCAGGTTCACCGGGTGGATAATG
TGCCTGTCGGACTGGCGATGCCACTTTCACTGACGACCCGTATCGGGCATGCAATGGTGGCCAGTTACGA
GATGATATTCACCCAGCCTGACAGCGCCACCTACAGCAAGACAGGCATGCTGTTCGGGGCGAACCTGATT
GTGAAAAGCACCGATTTTCTGTCCCGGAATCCGGAAATCATCAATCTGTTTCAGGACTACGTCCAGAACT
GCGTGCTGGGGGATATTTACCTGAACCACAAATACACGCTGGAAGACCTGATGGCCTCCGCTGACCCCTA
CACGCTGATTTTTTCCCGGCCCAGCCCGCTACGGGGCGTTTATGACAGCAATAATAATTTCATAACCTGT
AAAGATGCGTCGGTCACGCTGAAAGACAGGCTGAATCTCGATACAAAGACGGGAGGCAAGACCTGGCATT
ATTATGTGCAGCAGATATTTGGCGGCAGACCGGACCCGGACCTGTTATTCAGGCAACTGGTGAGTGACAG
TTACAGTTATTTCTACGGCTCCAGCCAGTCTGCCAGTCATATTATGCGCCAGAACGTCACCATGAATGCC
CTGAAAGAGGGTATCACCAGTAATGCAGCCCGTAACGGTGATACCGCCAGCCTGGTCAGTCTGGCCACGA
CTTCGTCGATGGAGAAACAGCGTCTGGCACATGTCTCCATTGGTCATGTGCTGATGCGAAACCTGCCGAT
GGTGCAGACCATTCTGGTGGGCATTACCATTGGTATCTTCCCGCTCCTGGTACTGGCGGCTGTCTTCAAC
AGACTGACGCTGTCTGTTCTGAGAGGCTATGTGTTTGCTCTGATGTGGTTCCAGACCTGGCCGTTGCTGT
ATGCCATTCTGAACAGTGCCATGACATTCTATGCAAAGCAGAATGGTGCACCGGTCGTGCTCTCTGAACT
CTCTCAGATACAGCTGAAATACTCCGACCTGGCGTCCACTGCCGGATATATATCTGTCATGATACCCCCG
TTGTCATGGATGATGGTAAAAGGCCTTGGCGCAGGTTTTTCCAGCGTGTACAGCCATTTCGCTTCCTCTG
CTATCAGCCCGACTGCCAGTGCGGCAGGTAGTGTGGTTGACGGTAATTACTCCTACGGCAACATGCAGAC
GGAAAACGTGAACGGCTTCAGCTGGAGCACCAACAGCACCACGTCGTTTGGTCAGATGATGTACCAGACC
GGCAGTGGCGCAACTGCCACACAGACCCGTGACGGTAATATGGTGATGGATGCGAGCGGGGCGATGTCCC
GGTTACCGGTCGGTATCAATGCAACGCGTCAGATTGCAGCGGCACAACAGGAAATGGCCCGGGAGGCGTC
GAACAGAGCAGAAAGCGCCCTGCATGGGTTCAGCAGCAGTATTGCCAGTGCCTGGAACTCGCTCAGCCAG
TTTGGTTCTAACCGGGGGAGCAGTGATTCTGTCACAGGTGGTGCTGACAGCACGATGAGCGCACAGGACT
CCATGATGGCCAGCCGTATGCGCAGTGCAGTGGAAAGCTATGCGAAGGCGCATAATATCAGTAATGAGCA
GGCGACTCAGGAACTGGCATCCAGAAGTACGAGAGCTTCTGCCGGGATGTATGGAGATGCTCATGCTGAA
TGGGGGGTTAAACCTAAAATTCTTGGTGTTGGTGGAGGATTAGGCGTTAGAGGTGGTGGTCGGGCTGGTA
TTGATTGGGAAGATAATGATGCGCATACGGCAAGTAGTAATACTCAGTCGAGCCATAATGCTCGTCATGA
TATCGATGCCAGAGCTACACAAGACTTTAAAGAGGCCAGCGATTATTTTACCAGTCGCAAGGTCAGTGAG
TCCGGCAGCCATACGGACAATAATGCTGATTCCCGTGTGGATCAGTTGTCTGCAGCCCTGAATTCAGCGA
AGCAGAGTTACGACCAGTACACGACGAATATGACCCGCAGCCATGAATATGCTGAAATGGCATCCCGTAC
TGAAAGCATGAGTGGGCAGATGAGTGAAGACCTGTCGCAACAGTTTGCACAGTATGTAATGAAACACGCG
CCACAGGATGCAGAAGCTATTCTGACAAACACCAGTTCACCGGAGATTGCAGAACGTCGTCGGGCGATGG
CCTGGTCTTTTGTGCAGGAACAGGTACAGCCTGGTGTTGATAATGCCTGGCGGGAATCCCGTGGTGATAT
TGGTAAAGGAATGGAGAGCGTACCTTCGGGTGGTGGCAGTCAGGATATTATTGCTGACCATCAGGGGCAT
CAGGCCATTATTGATCAAAGAACGCAGGACAGTAATATCCGTAATGATGTAAAACATCAGGTTGATAATA
TGGTCACAGAATATAAAGGGAATATAGGTGATACTCAGAACAGCGTACGTGGCGAGGAAAATATTGTAAG
AGGACAGTATTCTGAACTGCAGAATCACCATAAAACAGAGGCATTATCTCAGAATAATAAATATAATGAA
GAAAAGTCGGCTCAGGAAAGAATGCCCGGGGCTGACAGTCCACAGGAACTGATGAAAAGGGCAAAGGAAT
ATCAGGATAAGTATAAGCAATAA
 Primer design