SecReT4
Protein ID: 9507649
T4SS name [ID]Tra_F [114]
Gene symboltraD
Locus tagD742_p2075
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]76250..78466 [+]
Producthypothetical protein
Component typeTraD_F
UniProt IDQ7AK62
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 5e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 2.4e-33, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1.1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 2e-10, Aligned region: 187..491
T4SS-DNA_transf [PF02534], Evalue: 9.9e-08, Aligned region: 382..478
Protein Sequence: 738 a.a.     [Download]
>gi|9507649|ref|NP_052980.1| traD [Shigella flexneri 2b]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILIGLVLWVKISWQTFINGCIYWWCTSLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGDPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPQQPQQPQQ
PQQPQQPQQPQQPQQPVSSVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYE
AWQQENHPDIQQHMQRREEVNINVHRERGEDVEPGDDF
 
Nucleotide Sequence: 2217 bp     [Download]
>gi|9507549|ref|NC_002134.1|:76250-78466 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGCC
AGATCGCCAATATCATGCTTTACTGCCTGTTTATTTTTTTCTGGATCCTCATTGGTCTGGTCTTATGGGT
AAAAATAAGCTGGCAGACGTTTATCAACGGCTGTATTTACTGGTGGTGTACGTCACTGGAAGGCATGCGG
GATTTAATAAAATCCCAGCCGGTCTATGAGATCCAGTATTACGGCAAAACCTTCCGGATGAACGCTGCCC
AGGTACTGCATGATAAATATATGATCTGGTGCGGAGAGCAGCTATGGTCTGCATTCGTTCTGGCGTCTGT
CGTGGCCCTGGTTATTTGCCTGATCACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAGTCACAGGTGGTCGTCAGCTGACAGACAATCCGAAAGACGTTGCCCGGATGCTGA
AAAAAGACGGCAAGGACTCCGATATCCGGATTGGCGACCTGCCGATTATCCGGGATTCCGAAATCCAGAA
CTTCTGTCTGCACGGCACGGTCGGGGCCGGTAAGTCGGAGGTTATCCGTCGTCTGGCCAACTATGCCCGT
CAGCGCGGTGATATGGTGGTGATTTATGACCGTTCAGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAAATCCTGAATCCGCTGGATGCCCGCTGTGCCGCATGGGATTTGTGGAAGGAGTGCCTGACACA
GCCGGATTTTGATAATACCGCGAACACGCTGATCCCGATGGGTACAAAAGAGGACCCGTTCTGGCAGGGT
TCAGGACGTACCATTTTTGCGGAAGCGGCGTACCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACACTGCTTTCCATCAAAATTGAAAAACTGCGTACCTTCCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATTGAGAAAACGGCGATTTCCATCCGTGCTGTGCTGACCAACTACGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGATCCCTTCACCATCCGTGACTGGATGCGTGGTGTCC
GGGAAGATCAGAAAAACGGCTGGCTGTTTATTTCGTCGAACGCCGACACCCATGCCTCCCTGAAGCCTGT
GATCTCCATGTGGCTGTCCATTGCCATTCGTGGTCTGCTGGCAATGGGAGAAAACCGTAACCGTCGTGTG
TGGTTTTTCTGTGATGAGTTACCCACGTTACACAAACTGCCGGATCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCGGCCACGCTGTTTGACGTCATGAACACCCGTGCTTTTTTCCGTTCCCCGAGCCATAAGATTGCA
GAGTTCGCTGCCGGTGAGATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAGCAGTATTCCTACGGTGCTG
ACCCGGTACGTGACGGGGTATCGACCGGTAAGGATATGGAGCGTCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCTCTGCCGGATCTGACCTGCTATGTCACTCTGCCCGGACCGTATCCGGCAGTCAAACTCTCTCTG
AAATATCAGGCACGACCGAAGGTCGCTCCGGAGTTTATTCCGCGTGACATCAACCCGGAAATGGAGAACC
GTCTGAGTGCCGTACTTGCCGCAAGGGAAGCAGAAGGTCGTCAGATGGCCAGCCTCTTTGAACCGGAGGT
TGCCTCCGGAGAAGATGTGACTCAGGCTGAACAGCCACAACAGCCACAACAGCCACAACAGCCACAACAG
CCACAACAGCCACAACAGCCACAACAGCCACAACAGCCACAACAGCCAGTGTCTTCTGTCATCAATGATA
AGAAGTCAGATGCAGGTGTGAGTGTTCCGGCAGGGGGGATCGAGCAGGAGCTGAAAATGAAACCGGAAGA
AGAGATGGAACAGCAACTGCCACCCGGGATCAGTGAATCCGGTGAAGTGGTGGATATGGCCGCTTATGAG
GCATGGCAACAGGAAAATCATCCGGACATCCAGCAGCATATGCAGCGTCGTGAAGAGGTGAACATTAATG
TGCACCGGGAGCGCGGGGAGGATGTTGAGCCGGGAGATGATTTCTGA
 Primer design