SecReT4
Protein ID: 9507651
T4SS name [ID]Tra_F [114]
Gene symboltraX
Locus tagD742_p2056
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]83756..84502 [+]
Productpossible pilin acetylase
Component typeTraX_F
UniProt IDQ7AK61
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 6.4e-53, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|9507651|ref|NP_052982.1| possible pilin acetylase [Shigella flexneri 2b]
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERLALLACLLAVIPALNLASSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|9507549|ref|NC_002134.1|:83756-84502 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGT
CGTTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCGCTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATTCTTCTGATGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCGGTCAGTTACCGACTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGCTTGCATGCCTGCT
GGCCGTTATTCCGGCACTTAACCTTGCCTCCAGTGATGCAGCGGCGGTGGCCGGTCTTGTAATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGG
TATTCTACGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGTTGTGA
 Primer design