SecReT4
Protein ID: 9507788
T4SS name [ID]Tra_F [8]
Gene symboltraL
Locus tagD616_p97069
StrainPlasmid F
Repliconplasmid F [GenBank: NC_002483] [Browse all T4SS(s) in this replicon]
Location [Strand]68645..68956 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDP08321
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|9507788|ref|NP_061454.1| traL [Escherichia coli K-12]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|9507713|ref|NC_002483.1|:68645-68956 Escherichia coli K-12 plasmid F DNA, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design