SecReT4
Protein ID: 9507804
T4SS name [ID]Tra_F [8]
Gene symboltraF
Locus tagD616_p97073
StrainPlasmid F
Repliconplasmid F [GenBank: NC_002483] [Browse all T4SS(s) in this replicon]
Location [Strand]81068..81841 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDP14497
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.7e-78, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|9507804|ref|NP_061470.1| traF [Escherichia coli K-12]
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQT
ATKRALYEAILYPGVDNFVKYFRLQNYWAQQAGLFTMSARKAMLAHPELDYNLQYSHYNGTVRNQLAADQ
AQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQR
LGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 774 bp     [Download]
>gi|9507713|ref|NC_002483.1|:81068-81841 Escherichia coli K-12 plasmid F DNA, complete sequence
ATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTA
TTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGA
AAATAAACCTGTACCTGCAGCCCCCCGTCAGGAACCGGATATTATGCAGAAACTGGCCGCACTGCAGACG
GCAACAAAGCGGGCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGC
TGCAAAATTACTGGGCTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAGAAAGGCCATGCTGGCACATCC
TGAACTGGACTATAACCTGCAGTACAGTCATTACAACGGCACGGTACGGAACCAGCTGGCAGCAGACCAG
GCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGG
ACCCCATCGACGGGCAACTGGCGCAGGTCATTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCC
CGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGC
CTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCAT
ACGGCTTTATTTCGCAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCCAATTT
TTAA
 Primer design