SecReT4
Protein ID: 9507807
T4SS name [ID]Tra_F [8]
Gene symboltraQ
Locus tagD616_p97070
StrainPlasmid F
Repliconplasmid F [GenBank: NC_002483] [Browse all T4SS(s) in this replicon]
Location [Strand]82601..82885 [+]
Producthypothetical protein
Component typeTraQ_F
UniProt IDP18033
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.2e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|9507807|ref|NP_061473.1| traQ [Escherichia coli K-12]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|9507713|ref|NC_002483.1|:82601-82885 Escherichia coli K-12 plasmid F DNA, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTGAT
TGCGGCCATTCTCGTACTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design