SecReT4
Protein ID: 9507818
T4SS name [ID]Tra_F [8]
Gene symboltraX
Locus tagD616_p97063
StrainPlasmid F
Repliconplasmid F [GenBank: NC_002483] [Browse all T4SS(s) in this replicon]
Location [Strand]97963..98709 [+]
Producthypothetical protein
Component typeTraX_F
UniProt IDP22709
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 3.3e-50, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|9507818|ref|NP_061484.1| traX [Escherichia coli K-12]
MTTDNTNTTRNDSLVARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQSWMFLAGRGAFPL
FALVWGLNLSRHAHIRQLAINRLWGWAVFSQFWYYFAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILMMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRMERLVLVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCAGKLLSRFWPGDFFPTFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|9507713|ref|NC_002483.1|:97963-98709 Escherichia coli K-12 plasmid F DNA, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGTTGCCCGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTTCTGGA
CCATGCAAACCGTATTCTGCATCTGGACCAGTCGTGGATGTTTCTAGCCGGGCGCGGGGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACTGGCCATTAACCGGCTGT
GGGGATGGGCAGTTTTTTCCCAGTTCTGGTATTACTTTGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACATGGTGTGAAACGCGCAGTGGGTGGCGTACTGCAGCG
GCCATTCTCATGATGGCACTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCTGTCAGCCACCGGCTGTACCGGGCGGAAGACAGAATGGAACGTCTGGTGCTTGTCGCTTGCCTGCT
GGCCGTGATTCCGGCGCTTAACCTTGCCACCAGTGATGCGGCGGCTGTAGCCGGCCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGGAAATTATTATCCCGTTTCTGGCCCGGAGACTTTTTCCCGA
CGTTCTATGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTGA
 Primer design