SecReT4
Protein ID: 99077929
T4SS name [ID]VirB [774]
Gene symbol-
Locus tagTM1040_3794
StrainRuegeria sp. TM1040
Repliconplasmid unnamed [GenBank: NC_008042] [Browse all T4SS(s) in this replicon]
Location [Strand]43437..45443 [+]
ProductTRAG protein
Component typeVirD4
UniProt IDQ1GN40
KEGG IDsit:TM1040_3794
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-86, Aligned region: 131..540
TraG-D_C [PF12696], Evalue: 1e-28, Aligned region: 390..511
TrwB_AAD_bind [PF10412], Evalue: 2.6e-18, Aligned region: 139..525
AAA_10 [PF12846], Evalue: 1.5e-08, Aligned region: 138..471
Protein Sequence: 668 a.a.     [Download]
>gi|99077929|ref|YP_611188.1| TRAG protein [Ruegeria sp. TM1040]
MSDAMGKARIATGILLVTLVTGAMGYTIASAVLSHQDLGFGAEIDFAYIAQNYLAILDRRPEDAQLIHLI
IGSFAAAGLMLSLALSGSALTRFGQTHWQSAREMKANGFFGAPGTGFILGKLGTPKSRAKFVCSKVFPHA
LIVAPTGRGKTTGFVIPNLLTWQGSAVTLDVKGECFEATARHRAAQGDKVYRFAPTDWEGKRTHRYNPLL
RIYQLKDPARQQMELQLLATLFLQSDNDRVQGLLKGGIDLFVAAGLLAFQRKRPTLGEIYRIAASGGNKQ
KEYFARGHEVDNRAAKLIFTRLASTNNDTLTSYVSLLMTSGLDQWQNPAIDEATAVSDFDFRTIRKKPFS
VYLVVQPLMVKPLAPLIRLFFSDLLSAMQEKDPGPDEPWPVMIMLDEFNRLGKMPIVVESIETLRSYSGH
LAVVTQTIPALDEIYGENTRRALQGNAGVKLYLTPSDEKTVEELSKAVGKTTKTVVTRSQSIGKNPFEGR
SQSTRTEESSLLPEDEARRLPLDEIVMVIDAQMPVRAKRIQYFDDRLFKTIHDAQTGDLPFPEPGGAQGK
LPLTMRAMPMAPPPDESSGPEADGKAARQTADGQSSGPSGAVPKKTAPIVQAVIAEAQRQMEMDLEGAVA
DAEAARIVDEAQMRSAVDGLNDMEAMLQEDRGQKLVGR
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|99077902|ref|NC_008042.1|:43437-45443 Ruegeria sp. TM1040 plasmid unnamed, complete sequence
TTGAGCGACGCCATGGGAAAAGCGCGGATCGCAACTGGGATCTTGCTCGTCACGCTGGTGACCGGGGCCA
TGGGATATACCATCGCCTCGGCGGTTCTGAGCCACCAGGATCTCGGCTTCGGGGCGGAGATCGACTTTGC
TTATATCGCGCAGAACTATCTGGCGATCCTCGATCGCCGCCCGGAGGACGCGCAACTCATCCACCTGATC
ATCGGCAGCTTCGCCGCTGCCGGCCTGATGCTGAGCCTTGCCCTGTCGGGCTCGGCCCTCACACGCTTTG
GCCAGACCCATTGGCAGTCTGCGCGCGAGATGAAGGCCAACGGGTTTTTCGGCGCTCCCGGGACCGGGTT
CATCCTTGGTAAGCTCGGGACACCAAAATCCCGCGCGAAATTCGTCTGCTCAAAAGTCTTCCCGCACGCG
CTGATCGTGGCCCCCACCGGGCGCGGCAAGACCACGGGCTTCGTCATTCCAAACTTGCTGACCTGGCAAG
GCTCCGCCGTGACGCTCGATGTGAAGGGGGAATGTTTCGAGGCCACGGCGCGCCACCGCGCCGCCCAGGG
CGACAAGGTCTATCGCTTTGCTCCGACGGATTGGGAGGGCAAGCGCACGCATCGCTACAACCCGCTCTTG
CGCATCTATCAACTGAAAGATCCCGCGCGCCAACAGATGGAGTTGCAACTTCTTGCTACGCTTTTCTTAC
AGAGCGACAACGACCGGGTGCAGGGCCTCCTCAAAGGCGGGATTGATCTCTTTGTGGCAGCAGGCCTGCT
GGCGTTCCAGCGCAAGCGTCCGACCTTGGGCGAGATCTACCGCATCGCGGCCTCGGGCGGGAACAAGCAG
AAGGAGTATTTCGCGCGGGGCCATGAAGTTGACAACAGGGCGGCCAAGCTGATCTTCACGCGGCTGGCGT
CCACCAACAACGATACTCTGACGTCTTATGTTTCACTCCTGATGACCTCAGGGCTTGATCAATGGCAGAA
CCCCGCGATCGATGAGGCGACGGCAGTGTCGGATTTCGACTTCCGGACAATCCGCAAAAAGCCCTTCTCT
GTTTATCTCGTAGTCCAGCCGCTGATGGTCAAACCACTTGCCCCTCTGATCCGGCTCTTTTTCTCCGATC
TCCTTTCGGCGATGCAGGAAAAGGACCCTGGGCCGGATGAGCCGTGGCCTGTGATGATCATGCTCGATGA
ATTCAACCGTCTTGGCAAAATGCCTATCGTGGTCGAAAGCATCGAGACCCTCCGCAGCTATAGCGGTCAT
CTGGCCGTCGTCACCCAGACGATTCCCGCCCTCGATGAAATCTATGGTGAGAATACCCGCCGAGCCCTGC
AGGGCAACGCAGGGGTAAAGCTCTACCTAACCCCGTCTGACGAAAAAACCGTCGAGGAGCTGAGTAAGGC
GGTCGGCAAGACCACAAAGACCGTGGTCACGCGGTCGCAATCCATCGGCAAGAACCCCTTCGAGGGCCGC
AGCCAATCCACACGGACCGAAGAAAGCTCCTTGCTTCCTGAAGATGAAGCACGCCGCCTGCCACTCGACG
AGATCGTCATGGTCATCGATGCCCAAATGCCGGTCCGGGCGAAGCGAATCCAGTATTTTGACGACCGCCT
GTTCAAAACGATCCATGATGCACAGACGGGAGACTTGCCGTTTCCAGAGCCGGGGGGCGCGCAGGGTAAG
CTGCCACTTACTATGCGCGCGATGCCGATGGCACCGCCACCGGACGAGTCAAGCGGACCCGAGGCCGACG
GTAAGGCCGCACGCCAGACTGCTGACGGCCAATCGTCTGGGCCATCTGGCGCTGTTCCCAAGAAGACCGC
GCCCATCGTTCAAGCTGTGATCGCCGAGGCGCAGCGACAGATGGAAATGGATCTTGAAGGTGCAGTTGCT
GACGCTGAGGCCGCGCGCATCGTTGATGAGGCCCAGATGCGCTCCGCTGTCGATGGTTTGAACGACATGG
AAGCTATGCTGCAGGAGGATCGCGGTCAAAAGCTGGTTGGTCGGTAG
 Primer design