SecReT4
Protein ID: 99077947
T4SS name [ID]VirB [774]
Gene symbol-
Locus tagTM1040_3812
StrainRuegeria sp. TM1040
Repliconplasmid unnamed [GenBank: NC_008042] [Browse all T4SS(s) in this replicon]
Location [Strand]62362..63348 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDQ1GN22
KEGG IDsit:TM1040_3812
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.5e-57, Aligned region: 16..306
Protein Sequence: 328 a.a.     [Download]
>gi|99077947|ref|YP_611206.1| type II secretion system protein E [Ruegeria sp. TM1040]
MSLSYLQTSLDRIDAAARDDVIEICINPDGSCWGEFQGDHFMRKLDQALTATEVKDLGNQIASSANTTMS
KDRPIVSVSITYKGRPIRAQVITPPAVLSAMSISLRFFSSLPLDGIALDFLYGKERKLEKLRLKKTRELR
EVVAAGVIDDALAFCVDNKLNMIVSGGTSTGKTVAARKILSHVPADERIVTIEEAAELLPTQPNAVTLIA
NRDAEFQTADVLLTATLRMRPDRIILGEVRGKEAMTFLEAINTGHGGSMTTLHAETPQLAVQRLAIAALK
TEIPMTYADMIQYIENSIDVIIQAGRHDGRRGITEFYLPGATEIGVSQ
 
Nucleotide Sequence: 987 bp     [Download]
>gi|99077902|ref|NC_008042.1|:c63348-62362 Ruegeria sp. TM1040 plasmid unnamed, complete sequence
ATGTCGCTGAGCTATCTCCAGACCTCGCTTGATCGGATCGACGCCGCCGCCCGCGACGATGTTATCGAGA
TCTGCATCAATCCCGATGGCAGCTGCTGGGGTGAATTCCAGGGCGATCACTTCATGCGAAAGCTGGACCA
GGCGTTGACCGCAACGGAAGTGAAAGACCTCGGCAACCAGATTGCCTCCTCCGCAAACACCACCATGAGC
AAGGACCGCCCCATCGTCTCGGTCTCAATCACTTACAAGGGTCGCCCGATCCGCGCCCAGGTTATCACCC
CTCCTGCAGTGCTCTCAGCCATGTCCATCAGCCTTCGGTTCTTTTCAAGCTTGCCGCTCGACGGGATCGC
ACTCGACTTTCTCTATGGCAAGGAACGCAAGCTTGAAAAACTCCGCCTCAAGAAAACCCGGGAACTCCGC
GAGGTGGTGGCGGCGGGTGTGATCGATGATGCCCTCGCCTTCTGCGTCGACAACAAGCTCAACATGATAG
TCTCGGGCGGCACCTCCACCGGCAAGACCGTCGCCGCGCGCAAGATCCTCTCTCATGTGCCTGCTGACGA
ACGCATCGTCACCATCGAGGAAGCCGCCGAGCTTCTGCCGACCCAGCCAAATGCCGTGACGCTCATCGCC
AATCGCGACGCGGAATTCCAGACCGCCGATGTGCTGCTCACTGCCACGCTGCGCATGCGCCCCGACCGGA
TCATCCTGGGCGAGGTGCGGGGAAAAGAGGCCATGACGTTCCTCGAGGCGATCAACACAGGTCATGGCGG
GTCAATGACCACGCTTCACGCCGAAACCCCGCAACTCGCCGTGCAGCGCCTCGCAATCGCCGCGCTCAAA
ACCGAGATCCCGATGACCTATGCCGACATGATCCAGTACATCGAGAACTCCATTGACGTGATCATCCAGG
CCGGGCGCCATGACGGCCGACGCGGCATCACAGAATTCTACCTCCCCGGCGCAACCGAGATCGGAGTTTC
CCAATGA
 Primer design