SecReT4
Protein ID: 99077950
T4SS name [ID]VirB [774]
Gene symbol-
Locus tagTM1040_3815
StrainRuegeria sp. TM1040
Repliconplasmid unnamed [GenBank: NC_008042] [Browse all T4SS(s) in this replicon]
Location [Strand]65427..66080 [-]
ProductVirB8
Component typeVirB8
UniProt IDQ1GN19
KEGG IDsit:TM1040_3815
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5e-42, Aligned region: 6..211
Protein Sequence: 217 a.a.     [Download]
>gi|99077950|ref|YP_611209.1| VirB8 [Ruegeria sp. TM1040]
MASEQEIIEEELVYGALRRERLWQRLGLIGLIFGILGCLSAATVAILDVDPPPVVVPYDPATGFALPEAS
VGASSVTANQAIIEAEVFRYVTDREVYNQLDNDLRIRSVLRRSDGAAESRLRQIWNSANENYPPTVYGPN
ARLDVEILSINRIGTNRATVRLRKRLTSINGVQTGLFTATLLFEFRPETRRSIDEVWTNPFGFTVLEYSI
RSDRLEN
 
Nucleotide Sequence: 654 bp     [Download]
>gi|99077902|ref|NC_008042.1|:c66080-65427 Ruegeria sp. TM1040 plasmid unnamed, complete sequence
GTGGCGAGTGAACAAGAAATCATCGAAGAAGAGCTGGTCTATGGTGCGCTGCGCCGCGAACGGCTCTGGC
AGCGCCTTGGGCTCATCGGGCTCATCTTCGGCATTCTCGGATGCCTGAGCGCGGCGACTGTCGCAATTCT
CGATGTCGATCCGCCGCCTGTGGTCGTGCCCTATGATCCCGCAACCGGCTTTGCACTCCCCGAAGCCTCG
GTGGGCGCCTCCTCGGTGACCGCCAACCAGGCGATCATCGAGGCGGAAGTCTTCCGCTATGTGACCGACC
GGGAGGTCTACAACCAGCTAGACAACGATCTGCGCATCCGCAGCGTCCTGCGCCGCTCGGACGGAGCTGC
CGAGAGCAGGCTGCGCCAGATCTGGAACAGCGCCAACGAGAATTATCCGCCGACGGTCTATGGCCCCAAT
GCCAGGCTTGATGTCGAAATCCTCAGCATCAACCGGATCGGCACCAACCGCGCCACGGTCCGACTGCGCA
AGCGCCTGACGTCAATCAATGGCGTTCAGACAGGCCTTTTCACCGCCACGCTTCTCTTCGAGTTCCGCCC
CGAGACCCGCCGCTCCATCGATGAGGTCTGGACCAATCCCTTCGGCTTCACGGTCCTCGAATATTCCATC
CGCTCCGACAGATTGGAGAATTGA
 Primer design