SecReT4
Effector Protein ID: 148558306
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_A0115
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]121882..122343 [-]
Producthypothetical protein
Effector typeProtein
DescriptonBPE123
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDA5VTN6
KEGG IDbov:BOV_A0115
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 153 a.a.     [Download]
>gi|148558306|ref|YP_001257191.1| hypothetical protein BOV_A0115 [Brucella ovis ATCC 25840]
MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAAASNGLERAVKAIRNERTDLTDASAKL
DARLAETQRVRREMDEAIEELNRLRKALSRDMRQARILAETPPPRQEKTPSAAEQPLPADKNALPVFVRR
AVKKATVELAGQA
-
Nucleotide Sequence: 462 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c122343-121882 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGAGCTTGTTGCTGGCTAACGTGCTTTCCACATTGATGGCTCTTGCCTCGCTTGCGGCTTTGATCGTGG
TGGGCCGCAAGGCCAATGAAACCATCAGGCTCGGCAAGGTGCTGGCGCTGCGCGTCGCCGCCGCGTCAAA
CGGTCTGGAGCGCGCCGTAAAGGCGATCCGCAACGAACGTACCGACCTTACCGACGCCAGCGCCAAGCTT
GACGCCCGCCTTGCCGAAACGCAGCGCGTGCGCCGTGAAATGGACGAGGCGATCGAGGAATTGAACCGGC
TGCGCAAGGCGCTCTCGCGCGATATGCGCCAGGCGCGCATCTTGGCCGAAACGCCGCCACCCCGGCAGGA
GAAAACCCCGTCCGCCGCAGAACAACCGCTCCCCGCAGACAAGAACGCGCTGCCCGTTTTCGTGCGCCGC
GCGGTCAAGAAGGCAACCGTTGAACTGGCGGGACAGGCATGA
 Primer design

Reference
(1) de Jong MF; Tsolis RM (2012). Brucellosis and type IV secretion. Future Microbiol. 7(1):47-58. [PudMed:22191446]