SecReT4
Effector Protein ID: 148559075
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_1003
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009505] [Browse all T4SS(s) in this replicon]
Location [Strand]1011548..1012795 [-]
Producthypothetical protein
Effector typeProtein
DescriptonVceC
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDA5VQH9
KEGG IDbov:BOV_1003
PDB IDNA
Domain hit(s) vs Pfam FliO [PF04347], Evalue: 1.2e-07, Aligned region: 34..91
Protein Sequence: 415 a.a.     [Download]
>gi|148559075|ref|YP_001258976.1| hypothetical protein BOV_1003 [Brucella ovis ATCC 25840]
MLSGIIGESATNIVGFVLIFAIILGGIFVVLGIIRRFSGGTFVSSGRMRQPRLSVMDAAAVDSRRKLVLI
RRDDVEHLLLIGGPTDVVVEQNIVLESRAGTHAPGTHALGTHAQSSRIEPEHIERFRQHEVLANEKTERP
ALSVQSQPGDEREETIQLSSAIAAPVYRKPEPPKAENVRPAPSEPAPMRAPQPPVTPPPAAPRPEAPASQ
VSEPHPRPASNYPSQPRTVLPPRPAPSAAPNSVRAHPAYPLSQVSRGVVSSTSNIQAATVASAATANLGS
IVPERESAAPAKPAAPAPNQPERSERPERPERPQQRIEPVVPFVAQEVRQPESADDDLDDLGGTLHDAIM
ADLGSNAGKDENMEELDTASLEDELLSSLDISPTDEQPEDAKAEETIEDEMEKLLGELTKGETRN
-
Nucleotide Sequence: 1248 bp     [Download]
>gi|148558820|ref|NC_009505.1|:c1012795-1011548 Brucella ovis ATCC 25840 chromosome I, complete sequence
ATGCTCAGCGGCATCATCGGTGAAAGCGCGACTAATATTGTCGGCTTTGTGCTTATATTTGCAATCATCC
TTGGCGGAATTTTTGTTGTTCTCGGCATCATTCGCCGTTTCAGCGGCGGCACATTTGTATCCAGCGGGCG
CATGCGCCAGCCCCGCCTTTCGGTGATGGATGCCGCCGCGGTAGACAGCCGGCGCAAGCTGGTTCTGATC
CGCCGCGACGATGTGGAACATCTGCTCCTGATCGGTGGCCCGACCGATGTGGTTGTCGAACAGAATATCG
TTCTGGAATCGCGCGCTGGCACCCATGCCCCTGGAACTCATGCCCTTGGTACCCACGCACAGAGCTCGCG
TATCGAACCGGAACATATTGAACGCTTCCGCCAGCACGAAGTGCTTGCCAATGAGAAGACGGAACGGCCT
GCCCTTTCCGTCCAGTCCCAGCCCGGAGACGAACGCGAGGAAACTATTCAGCTAAGCTCGGCCATCGCGG
CGCCCGTCTATCGCAAGCCGGAGCCGCCGAAGGCTGAGAACGTCCGGCCCGCGCCCTCCGAACCCGCACC
AATGCGGGCACCGCAGCCTCCCGTGACGCCACCGCCAGCCGCGCCGCGCCCTGAAGCGCCTGCGTCGCAG
GTTTCCGAGCCGCATCCGCGCCCAGCTTCAAATTACCCGTCACAGCCGCGCACGGTTCTTCCCCCGCGCC
CCGCGCCATCGGCTGCCCCAAACAGCGTTCGCGCGCATCCAGCCTATCCGCTGAGCCAGGTTTCGCGCGG
CGTGGTAAGTTCCACATCAAATATCCAGGCAGCCACGGTTGCATCGGCCGCGACAGCAAATCTGGGCAGC
ATTGTGCCCGAACGCGAATCTGCCGCTCCGGCAAAACCCGCAGCGCCCGCGCCGAATCAGCCGGAACGTT
CAGAGCGTCCAGAACGCCCGGAACGCCCACAACAACGCATCGAGCCGGTTGTTCCCTTTGTCGCCCAGGA
AGTCAGGCAGCCCGAAAGCGCAGATGACGATCTGGATGACCTTGGCGGCACATTGCATGATGCCATTATG
GCCGATCTTGGCAGCAATGCCGGTAAAGATGAAAATATGGAGGAGTTGGACACGGCTTCGCTGGAAGACG
AACTACTCAGCTCGCTTGATATTTCACCTACCGATGAACAGCCGGAAGATGCCAAGGCCGAAGAAACCAT
CGAAGACGAAATGGAAAAGCTGCTTGGCGAGTTGACCAAGGGAGAAACCCGCAATTAG
 Primer design

Reference
(1) de Jong MF; Tsolis RM (2012). Brucellosis and type IV secretion. Future Microbiol. 7(1):47-58. [PudMed:22191446]