SecReT4
Effector Protein ID: 148559353
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_1218
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009505] [Browse all T4SS(s) in this replicon]
Location [Strand]1227858..1228619 [-]
Productrhomboid family protein
Effector typeProtein
DescriptonBPE275
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDA5VR25
KEGG IDbov:BOV_1218
PDB IDNA
Domain hit(s) vs Pfam Rhomboid [PF01694], Evalue: 2.1e-25, Aligned region: 84..240
Protein Sequence: 253 a.a.     [Download]
>gi|148559353|ref|YP_001259172.1| rhomboid family protein [Brucella ovis ATCC 25840]
MLPKDKREQHFMSIPQPEMRGTGGREPIFNIPGVVIALIGLCVAVYVYQNYILSERQDFEFMMNFALIPA
RFSMASGFVDPAVIFTFISYSFMHGSFAHIAVNMIWLAAFGSPLAGRIGAVRMILFWVFTSVVAGLTHYA
LHPESLSPLVGASGAISGMMGAAARYGFRRVGYGRRSEFAGPVLPIGLTLTLKPVLIFVGVWFLINIVTG
LYSTGGADFSSIAWEAHIGGFIAGFFGIPLMDRPRSYDAVLRR
-
Nucleotide Sequence: 762 bp     [Download]
>gi|148558820|ref|NC_009505.1|:c1228619-1227858 Brucella ovis ATCC 25840 chromosome I, complete sequence
ATGCTTCCGAAAGACAAGAGAGAGCAGCACTTCATGAGCATTCCCCAGCCGGAAATGCGCGGCACAGGCG
GCCGCGAGCCGATCTTCAATATTCCGGGTGTCGTGATTGCTCTGATCGGGTTGTGTGTCGCGGTCTATGT
CTATCAGAATTATATTCTGAGCGAGCGGCAGGATTTTGAGTTCATGATGAACTTTGCGCTGATCCCGGCG
CGCTTTTCGATGGCGAGCGGCTTTGTTGATCCGGCGGTGATTTTTACGTTTATCAGCTATTCCTTCATGC
ATGGCAGTTTTGCGCATATTGCCGTCAATATGATCTGGCTTGCCGCATTCGGCTCGCCGCTGGCCGGGCG
AATCGGCGCGGTCCGGATGATCCTATTCTGGGTTTTCACGTCGGTCGTCGCGGGGCTTACGCATTACGCA
CTCCATCCCGAAAGCCTTTCGCCGCTGGTGGGTGCGTCGGGCGCGATTTCGGGCATGATGGGAGCTGCCG
CCCGCTATGGTTTTCGGCGTGTCGGCTATGGCCGGCGCTCGGAATTTGCCGGGCCGGTGCTTCCCATCGG
GCTGACGCTGACGCTCAAGCCCGTCCTCATTTTTGTCGGCGTCTGGTTTCTCATCAATATCGTCACCGGC
CTTTATTCCACTGGCGGCGCCGACTTTTCCAGCATTGCCTGGGAGGCGCATATAGGCGGCTTCATTGCCG
GGTTTTTCGGGATTCCACTGATGGACCGCCCGCGCAGCTATGATGCCGTTTTGAGGCGATAG
 Primer design

Reference
(1) de Jong MF; Tsolis RM (2012). Brucellosis and type IV secretion. Future Microbiol. 7(1):47-58. [PudMed:22191446]