SecReT4
Effector Protein ID: 148559426
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_1928
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009505] [Browse all T4SS(s) in this replicon]
Location [Strand]1931547..1932008 [-]
Productcyclic nucleotide-binding protein
Effector typeProtein
DescriptonBPE005
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDA5VSX2
KEGG IDbov:BOV_1928
PDB IDNA
Domain hit(s) vs Pfam cNMP_binding [PF00027], Evalue: 9.8e-21, Aligned region: 35..122
Protein Sequence: 153 a.a.     [Download]
>gi|148559426|ref|YP_001259819.1| cyclic nucleotide-binding protein [Brucella ovis ATCC 25840]
MALDDDIRILGTVGLFESFTPEQLRLLAFGAERLVLRAGRELFREGQSADCAYIIVTGTITLFHEGDEGR
VTIRPVGPGAILGEMALIAQTTRLTGAVADVETEVIRISRSIFRRILEEYPEVAAALHAHISRNLVELIG
QIEQVAPRLANRD
-
Nucleotide Sequence: 462 bp     [Download]
>gi|148558820|ref|NC_009505.1|:c1932008-1931547 Brucella ovis ATCC 25840 chromosome I, complete sequence
ATGGCGCTAGACGACGATATTCGCATTCTCGGCACGGTGGGCCTGTTCGAGTCTTTCACGCCCGAACAGT
TGCGCCTGCTTGCCTTCGGTGCGGAGCGGCTTGTCCTGCGTGCGGGACGCGAGCTTTTCCGCGAGGGCCA
GAGTGCCGATTGCGCCTATATCATCGTTACCGGCACGATTACCCTGTTTCATGAAGGTGATGAAGGGCGG
GTCACGATCCGCCCTGTCGGCCCCGGCGCGATATTGGGGGAAATGGCGCTCATCGCCCAGACCACTCGTC
TCACCGGCGCGGTGGCGGATGTGGAAACCGAAGTCATCCGCATCAGCCGCTCCATCTTCCGGCGCATTCT
GGAAGAATACCCGGAAGTGGCCGCCGCGCTTCATGCGCATATCAGCCGCAATCTTGTCGAGCTTATCGGC
CAGATCGAGCAGGTCGCGCCGCGGCTTGCAAACCGCGACTGA
 Primer design

Reference
(1) de Jong MF; Tsolis RM (2012). Brucellosis and type IV secretion. Future Microbiol. 7(1):47-58. [PudMed:22191446]