SecReT4
Effector Protein ID: 148559495
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_1221
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009505] [Browse all T4SS(s) in this replicon]
Location [Strand]1230546..1231073 [-]
Productputative ferripyochelin-binding protein
Effector typeProtein
DescriptonRicA
T4CP requirementT4CP Indepedent
Target/EffectionRicA was demonstrated to interact with human small GTPase Rab2 involved in trafficking
UniProt IDA5VR28
KEGG IDbov:BOV_1221
PDB IDNA
Domain hit(s) vs Pfam Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 17..47
Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 75..105
Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 90..124
Protein Sequence: 175 a.a.     [Download]
>gi|148559495|ref|YP_001259175.1| putative ferripyochelin-binding protein [Brucella ovis ATCC 25840]
MPIYAYNGHKPQFADRESNWIAPDATLIGKVVVGENAGFWFGAVLRGDNEPITIGADTNVQEQTIMHTDI
GFPLTIGAGCTIGHRAILHGCTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKEGMEIPDNSLVVGSPA
RVLRQLDDAAVEKLRASAKHYVERGHSFMRGMEPA
-
Nucleotide Sequence: 528 bp     [Download]
>gi|148558820|ref|NC_009505.1|:c1231073-1230546 Brucella ovis ATCC 25840 chromosome I, complete sequence
ATGCCGATCTATGCATATAACGGGCACAAGCCGCAGTTTGCGGACCGCGAGAGCAACTGGATTGCACCGG
ATGCGACGCTGATCGGCAAGGTGGTCGTGGGCGAGAATGCGGGTTTCTGGTTCGGCGCGGTGTTGCGCGG
CGATAATGAGCCAATCACTATCGGTGCCGATACCAATGTGCAGGAACAGACGATCATGCACACCGATATC
GGCTTTCCGCTGACCATCGGTGCGGGCTGCACTATCGGGCACCGTGCGATTCTCCATGGCTGCACGATTG
GCGAGAATACTCTTATCGGCATGGGCGCGATTGTGCTCAATGGCGCGAAGGTCGGCAAGAATTGCCTTAT
CGGGGCGGGAACATTGGTGAAAGAAGGGATGGAAATCCCTGATAATTCGCTTGTTGTCGGCTCTCCCGCG
CGTGTCCTGCGCCAGCTTGACGATGCTGCCGTTGAAAAGCTGCGGGCCTCTGCAAAGCATTATGTGGAGA
GGGGACATTCCTTCATGCGCGGCATGGAGCCTGCCTGA
 Primer design

Reference
(1) de Jong MF; Tsolis RM (2012). Brucellosis and type IV secretion. Future Microbiol. 7(1):47-58. [PudMed:22191446]