SecReT4
Effector Protein ID: 148559637
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_1577
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009505] [Browse all T4SS(s) in this replicon]
Location [Strand]1589673..1589990 [+]
Producthypothetical protein
Effector typeProtein
DescriptonVceA
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDA5VRZ7
KEGG IDbov:BOV_1577
PDB IDNA
Domain hit(s) vs Pfam PepSY_2 [PF13670], Evalue: 1.7e-21, Aligned region: 5..85
Protein Sequence: 105 a.a.     [Download]
>gi|148559637|ref|YP_001259494.1| hypothetical protein BOV_1577 [Brucella ovis ATCC 25840]
MKIIITAAALVALSATGAMAQKTQCDAKPLDEKSIDALVQLSNEFTWKISEMEIDDGCYELHVTDENGNV
LKVKVDPETMKVVAGKVKRYGDGTPAKDKGHAPKN
-
Nucleotide Sequence: 318 bp     [Download]
>gi|148558820|ref|NC_009505.1|:1589673-1589990 Brucella ovis ATCC 25840 chromosome I, complete sequence
ATGAAAATCATCATCACGGCAGCAGCCCTGGTTGCACTGTCCGCCACGGGCGCAATGGCCCAAAAAACCC
AATGCGATGCAAAGCCGCTGGATGAGAAGTCCATCGATGCCTTGGTACAGTTGTCGAACGAATTTACGTG
GAAAATTTCCGAAATGGAGATTGACGACGGCTGTTATGAGCTGCACGTTACCGATGAAAACGGCAATGTC
CTCAAGGTCAAGGTGGACCCTGAAACGATGAAGGTGGTTGCTGGCAAAGTAAAGCGGTACGGCGATGGCA
CTCCGGCCAAGGACAAGGGCCACGCGCCCAAGAACTAG
 Primer design

Reference
(1) de Jong MF; Tsolis RM (2012). Brucellosis and type IV secretion. Future Microbiol. 7(1):47-58. [PudMed:22191446]