SecReT4
Effector Protein ID: 148560166
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_0990
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009505] [Browse all T4SS(s) in this replicon]
Location [Strand]997763..1002511 [-]
Producthypothetical protein
Effector typeProtein
DescriptonBPE043
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDA5VQG7
KEGG IDbov:BOV_0990
PDB IDNA
Domain hit(s) vs Pfam Apolipoprotein [PF01442], Evalue: 1.8e-39, Aligned region: 350..554
Apolipoprotein [PF01442], Evalue: 1.8e-39, Aligned region: 560..753
Apolipoprotein [PF01442], Evalue: 1.8e-39, Aligned region: 1015..1186
Apolipoprotein [PF01442], Evalue: 1.8e-39, Aligned region: 1237..1546
Protein Sequence: 1582 a.a.     [Download]
>gi|148560166|ref|YP_001258964.1| hypothetical protein BOV_0990 [Brucella ovis ATCC 25840]
MADKVFVTALNDPAVAVNEYEVGKEMASNSKAQKLDLEVEKALEQALDIDFGDDIDIDMDLGAFDEGFSI
DDLEEQISRAAEELVAEQQAKAAEPVGNEPVVKAASVITTASVIATPAAPPVPPVVKAASSAPAIAANTE
HKPANVVAEPVSAQETAAKPAAAVATATPVATPVRTPANDDSRSDKAIAAAPRRITEHSSKLYWTTTAIS
VLWAAGGVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVALPIAMFWGFAQLVKRAQEMENAARSMTD
AALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELETLVQSEVNQLERAYSDNEVRIRSLV
SDLGNEREAVVSHAERVRSSISGAHEQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGG
AIADAIEKRTGDIGNRITTSGEAFANLLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVS
EFDTRLANLENTLSDRGCSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNS
LGAMVDDIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAAR
TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSLEERTASLHNVIAGNQ
AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAESLGAGRDAFE
TALGEHVRTVEERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQ
RTTSLQNAIANSSAAISSAFEGQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAAST
LAAEAAKAGEALDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIEGRLTDELGTIEARIADTAAKT
SETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDTTAVTLEERT
RELNAVLAARSQEITKILNDTAEPLVQRLADSGCGLAQQLEEATHAATDRLRSENAALVNALASRTAETI
AAVQQAKVGLSDNVSELIDRLAASNGELGKLIDAATRNLADIDGRLVDSTTSFVENTNRAAQMFQASTGL
IDSNLGTLRTLSDNTLSQIADIADRFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSE
GVEKLMQSFEALVASSFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGE
LKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV
RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQPAATPRSPSHV
VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMD
DFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTMLAHASGRLR
-
Nucleotide Sequence: 4749 bp     [Download]
>gi|148558820|ref|NC_009505.1|:c1002511-997763 Brucella ovis ATCC 25840 chromosome I, complete sequence
ATGGCGGATAAAGTTTTTGTAACGGCTCTCAATGATCCGGCCGTCGCGGTAAATGAGTACGAGGTAGGCA
AAGAGATGGCTTCAAATTCCAAGGCACAGAAGCTCGACCTTGAGGTTGAAAAGGCGCTGGAACAGGCACT
GGATATCGATTTCGGAGACGATATTGATATCGATATGGACTTGGGTGCGTTTGACGAAGGCTTCTCGATT
GACGATCTGGAAGAGCAGATTTCCCGTGCCGCGGAAGAACTCGTCGCCGAACAGCAGGCGAAAGCCGCCG
AGCCTGTTGGAAACGAGCCGGTCGTCAAGGCCGCTTCGGTCATCACAACGGCTTCCGTGATTGCAACGCC
TGCTGCGCCTCCGGTGCCGCCTGTCGTCAAGGCGGCCTCCTCTGCTCCCGCTATAGCCGCCAATACCGAG
CACAAACCTGCCAATGTAGTTGCCGAACCCGTTTCAGCACAGGAGACCGCGGCCAAGCCTGCCGCTGCGG
TCGCCACTGCAACGCCGGTCGCCACGCCTGTTCGTACACCAGCAAATGACGATTCGCGCAGCGACAAGGC
CATCGCCGCCGCGCCGCGCCGCATCACCGAGCATTCCTCTAAGCTTTACTGGACCACGACCGCAATCAGC
GTGCTGTGGGCGGCTGGCGGCGTTGCTATCAGCAAGGCGATCAATCCGGAAGTCTTCTCCAGCCTGCAAG
CCACCAAAGATTTCTTCACCGCACCCGCCGGACTTGGTGTGGTTGCCGGTGTGGCGCTGCCGATCGCGAT
GTTCTGGGGCTTCGCACAACTCGTCAAGCGTGCTCAGGAAATGGAGAACGCTGCGCGCAGCATGACCGAT
GCCGCGCTCAAACTGCTTCAGCCGGAAGCTGTCGCGGGTGATCGCGTCTCCACGCTGGGCCAGGCCGTGC
GCCGCGAAGTTGCAGCCATGAACGAAGGCATCGAACGCACACTTGCGCGCGCGGTGGAGCTGGAAACGCT
CGTCCAATCCGAGGTCAACCAGCTTGAGCGCGCCTATAGCGACAATGAGGTGCGTATCCGCTCGCTCGTC
AGCGATCTTGGCAATGAGCGTGAAGCAGTTGTCAGCCATGCCGAGCGTGTTCGTTCGTCCATCTCTGGTG
CGCATGAACAGCTTAGGGAAGAATTATCAAGTGCATCCAATATCATACGCGACAATGTTCTGTCCGCGTC
TCAGCAGCTCAGCGCGCTCTTGGGCGATTCTGGCGAGCGCCTTATCAGCAATATCAACGAAAGCGGCGGC
GCTATTGCCGATGCAATCGAGAAGCGCACCGGCGATATTGGAAATCGCATCACCACCTCCGGCGAAGCTT
TTGCCAATCTGCTCGATACCCGCATCGCAACGCTTGACGAACAGTCGCGCACGATCTCCGGGAAGTTGAC
GCAGGCTCTGGACGAGCGCACCACCGGCATTGCAAATGTGCTTGGCAGCGCGACCCAGACCATGGTGAGC
GAGTTCGACACGCGCCTTGCCAATCTGGAAAACACCCTTTCCGACCGTGGCTGCTCGTTGCTGGCAGAGT
TTGAGGCGCGCGCCCATGCGCTTGACAACAGCACCGAAAAGCTGAATGCGGCGCTGGAAACCCGTTCGCG
CCAGATCAACGAAAACCTCATTGCCCGCACCCGTGAAATCGCCGAAACCTTCTCGGGCGGCCGCAATTCG
CTGGGCGCGATGGTGGACGACATCAAGGTGAAGATCGGCGACGATCTGACCTCGATCAGCGAAAGCGTCG
GCAATGTTCTGATCGATAAGGCAGCAGCCTTCGAGGGCAAGCTGGCCGAAAGCCGCGATCTTCTGGCGGC
AACGCTGGAAGGCGAAACAGAGCGCGTTTCCTCGGTCATTCGCGGCCATGCGGATACGCTTGCCGCGCGC
ACCGGCGATATCCAGAACGCTATCGATGCAAGCGCCTCAGCGCTCAATGAAGTCACAGACAAGCACGCGG
CAATCTTGGCCGAGCGCACCAGTGCGCTGCAGCAGGCCATGTCCAGCAATGTTTCCCTGCTGGATGCGAG
CTTCGCAGACCATGCCCGTTCACTTGAAGAGCGCACTGCGTCCCTGCATAATGTCATTGCAGGAAATCAG
GCAATGCTGGCTCAGCTCATGGATGAGCGTGCGGCTGCAATGCGCGAGAATTTCAACGAAAATCGTGAAG
TGCTGGCCCGCACCTTCGATGAACGTATTGGCAGCCTTCAGTCGCTTATCGCGGAAAACCAGAGCGCCCT
TGAGCGTATTCTGGATGAGCGCGCGCGCAATATGGCGGAATCCCTCGGCGCTGGCCGCGATGCCTTTGAA
ACGGCACTGGGCGAGCATGTCCGCACGGTCGAGGAACGCACAAGCGGCTTGCAAGCCGTTCTGAACAACC
ACAATGATGCGCTGGCGCATGTTCTGGATGGACATGAGCAGACCATTGAAACGCGGGCCGCTGAAATCCG
CTCCACCCTGACGGACAGCACGGCTTCGCTCAGCCAGACCTTGCAGGATCATGGCGAGATTCTGGAGCAG
CGCACCACGAGCCTGCAAAACGCCATCGCCAACAGCAGCGCCGCCATCAGCAGCGCCTTTGAGGGCCAGA
CCGGCATTATCGAAGAACGCACCGAGACCATGGAAAAGGCTCTTTCCATCGGCGTGGACAATGTGCGCCG
CGCACTGGAACAAAGTGCAGGCGTGGTCGCCGGAAAGCTGCGTGAAAAGATCGGTGAAGCTGCCAGCACA
CTTGCCGCTGAGGCCGCCAAAGCCGGCGAAGCCCTCGACGGCTTTGGCGAAAGCTTCAGTGCTCGGCTCA
TCGATAATCTTTCCGGCACCGAAGCCCGCCTCGGCGAACGCGCGGATGCTATTGCCGGACGCCTTGGCGA
CATTGAAGGCCGCCTTACCGACGAGCTTGGGACCATTGAGGCACGCATTGCCGATACGGCCGCCAAAACA
AGCGAAACGCTTGCCAGCCACAGCGAATCCTTCTCGGCCAGCGTTGCCGACAATCTCGCTGGCACAGAAA
CACGTCTTGTCGAGCGTGCGGATGCGATCGCAACCCGTCTTGGCGATATCGGCTCGCGCATCACGATGGA
GCTCGGCTCCGTCGAGGCTCGCATTGCGCAGGTGACGGATACGACGGCGGTTACGCTGGAAGAACGCACC
CGTGAGCTCAATGCCGTCCTCGCCGCTCGCTCGCAGGAAATCACCAAAATCCTCAACGATACGGCCGAAC
CGCTGGTTCAGCGCCTTGCCGATAGTGGCTGTGGCCTTGCCCAGCAGCTTGAAGAAGCAACCCATGCAGC
AACTGATCGCCTGCGTTCGGAAAATGCGGCGCTCGTCAATGCGCTGGCAAGCCGCACGGCGGAAACCATC
GCTGCGGTCCAGCAGGCAAAGGTCGGGCTTTCCGACAATGTCAGCGAACTCATTGACCGCCTCGCCGCTT
CCAATGGTGAGCTTGGCAAGCTGATTGATGCCGCCACGCGCAACCTTGCCGATATCGATGGGCGTCTGGT
GGACTCTACGACGAGCTTTGTGGAAAACACGAACCGCGCGGCGCAGATGTTCCAGGCTTCAACTGGCCTC
ATCGACAGCAATCTCGGTACGCTTCGTACGCTATCCGACAATACCTTGTCGCAAATCGCCGATATTGCCG
ACCGCTTCGATGAACATGGCAAGGTTCTGTCTTCGGCATCCGATATGATCAATTCCGCACAGAACGGCCT
CGTCAGCACACTTGAGGAGCGTCATCAGGCGCTCGACAAGCTGGCTTCCGGTCTGGTGGAAAAATCGGAA
GGCGTCGAAAAGCTCATGCAATCCTTCGAGGCTCTGGTTGCCTCGTCCTTCCAGCGCGCCGAAGGCCAGA
CCCGCGTTTCGGCGGAAAAGATGCGCGAGAGCGTTTCGGATATCGTCGAACAGGCCGCACAGAAGTTCTC
GGCAGCGACCGACGAAATTCGCCGCACGGCAAGCGAAATCCGCGCCGAACTCGATACAACGCGCGGCGAA
CTGAAGCGTGGCGTTCTCGACATGCCTGCCGAAGCGAAGGAAACGACGACCGCCATGCGCAAGGCCGTGA
GCGAGCAGATCAACGCGCTCAAGGAACTTGCTGAAATTGTCAACAAGTCGGGCCGTCTGGTTGATGTGGG
TGAAGGCCGTGCCGACCGCCCTGTGTCGCGCCCCGCAGCATCTCGCCCTGCTCCGGTTCAAGCTCCTGTT
CGGGCACCGATCGCGCCTCTGGCACAGACAGATGTTGCGGTCCGGTCGCGTCCGGTGGAAGCGCCGAACC
AAAAGCCTGCTCCAGCGGCATCTGCGGAAAAGCCGCGCGGTTGGGTTTCCGATCTTCTTGCCCGCGCCTC
ACGTGAGGAAGAAGAAGCCGCGCAGCCCAAGGTGCAGCCGGCCGCAACGCCGCGTTCTCCGAGCCATGTG
GTTGAATCGCTCAACTCGCTTTCCGTCGATATCGCCCGTGCTATCGACCACGAAGCTTCGGTTGAGCTTT
GGGACCGTTATCGCCGCGGTGAGCGCAATGTTTTCACCCGCCGTCTCTATACGCTGAAAGGTCAGCAGAC
CTTTGACGATATCAAGCGCAAGTATCAGACCGATGGTGAATTCCGCCGCGCCGTAGATCGTTACATGGAC
GATTTCCAGCGTCTTCTCGAAGACGTTGCCCGCAATGACCGCGATAATATGGTGACGCAGACTTACCTGA
CATCCGACACAGGCAAGGTTTACACCATGCTCGCCCATGCAAGCGGACGCCTTCGGTAG
 Primer design

Reference
(1) de Jong MF; Tsolis RM (2012). Brucellosis and type IV secretion. Future Microbiol. 7(1):47-58. [PudMed:22191446]