SecReT4
Effector Protein ID: 188527607
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04145
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]804109..807594 [-]
Productcag pathogenicity island protein CagA
Effector typeProtein
DescriptonCagA
T4CP requirementT4CP Depedent
Target/EffectionCagA can cause gastritis and peptic ulcer, Injected CagA can act as a ‘master key’ that evolved the ability to highjack multiple host cell signalling cascades, which include the induction of membrane dynamics, actin-cytoskeletal rearrangements and the disruption of cell-to-cell junctions as well as proliferative, pro-inflammatory and anti-apoptotic nuclear responses (Backert et al, 2010).
UniProt IDB2UTT2
KEGG IDhps:HPSH_04145
PDB IDNA
Domain hit(s) vs Pfam CagA [PF03507], Evalue: 2.5e-85, Aligned region: 865..1039
Protein Sequence: 1161 a.a.     [Download]
>gi|188527607|ref|YP_001910294.1| cag pathogenicity island protein CagA [Helicobacter pylori Shi470]
MANETINQTKNPDQTPNQTAFDPQQFINNLQVAFIKVDSAVASFDPDQKPIVDKNDRDNRQAFNGISQLR
EEYANKAIKNPNKKNQYFSDFINKSNDLINKDNLIDTDSSTKSFQKFGPEPYQIFMNWVSHQKDPSKINT
QKIRDFMENIIQPPISDDKEKAEFLRSAKQSFAGIIIGNQTRSDEKFMGVFEESLKEKQEAEKKGEPSGD
WLDIFLSFVFNKKQSSDLKETLNQEPRPNVEQNIATTPTPIQGLPLEARDLLDERGDFSKFTLGDMEMLD
VEGVADIDPNYKFNQLLIHNNALSSMLMGSHGNIDLEKVSLLYGDNGGPEARHDWNATVGYKNQQGNNVA
TLINAHLKNGSGLIIAGNENGINNPSFYLYKKDQLTGLEQALSQEEIQNKLGFMEFLAQNSARHVGLNNL
SKEEKEKFQTEIGNFQKDPKAYLDTLGSDHIAFVSKKDQKHLALVTEFGNGELSYTLKDYGKKPDRALDR
ETKTTLQGNLKDDGVMFVNYSNFKYTNASKSPNEGIGATNGVSHLEANFSKVAVFNLPDLNGLAVSSFAR
RNLEDKLAAKGLSGKESNKLIKDFLSSNKELLEKVLNFNKAVAEAKNTGNYDGVKKAQKDLEKSIRKRER
LEKEITKQFESKSGNKNKMEAKAQANSQKDEIFKLINEGAYKEARIIAYAQNLKGIRRELSDRMGNINKN
LKDFNQSFDALKSGKNKDFSKVEETLKALKSSVKDLNINPEWISKVENLNVALNEFKNGKNKDFSKVTQA
KSDLENSIKDVHINQQITDKVDNLNQAVLVAKATGDFSRVEQALAGFKKFLTDQKNENFNVGKNSDLQSV
KNGVNGTLVGNGLSVTEATTLTKKFSDIKKELNEKFANFNKNSNGLKNSAEPIYAQVNKKKTGQVASPEE
SIYTQVAKEVNEKINRLNEKASASKGVGNFSGAGRLDSPEPIYATIDDLGGSSPLKRHAKVDDLSKVGLS
REQELTQKIGNLNQAVSEAKAGSFGNLERTMDGLKDSTKKNVVNLWFEGARKVPISLQAKLDNYATNSHT
RINSNVKNGTINEKATIMLTQKNPEWLKLVNDKIVAHNVGSTPLSDYDKIGFNQKNMKDYSDSFKFSIKL
SNAVKNIKSGFVQCLTDCISAGSYSPKKAEHGVTKSGFQKS
-
Nucleotide Sequence: 3486 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c807594-804109 Helicobacter pylori Shi470 chromosome, complete genome
ATGGCTAACGAAACCATCAATCAAACAAAAAATCCAGATCAAACACCAAACCAAACGGCTTTTGATCCAC
AACAATTTATCAATAATCTTCAAGTGGCTTTCATTAAAGTTGATAGCGCTGTCGCTTCATTTGATCCCGA
TCAAAAACCAATCGTTGATAAGAACGATAGGGATAACAGGCAAGCTTTTAATGGAATCTCGCAATTAAGG
GAAGAATACGCCAATAAAGCGATCAAAAATCCCAACAAAAAGAATCAGTATTTTTCAGACTTTATCAATA
AGAGCAATGATTTGATCAACAAAGACAATCTCATTGATACAGATTCTTCCACAAAGAGCTTTCAGAAATT
TGGGCCTGAGCCTTACCAAATTTTTATGAATTGGGTGTCCCATCAAAAAGATCCGTCTAAAATCAACACC
CAAAAAATCCGAGATTTTATGGAAAATATCATACAACCCCCTATCTCTGATGATAAAGAAAAAGCGGAGT
TTTTGAGGTCTGCCAAACAATCTTTTGCAGGAATTATCATAGGAAACCAAACCCGATCGGATGAAAAATT
CATGGGCGTGTTTGAAGAATCTTTGAAAGAGAAGCAAGAAGCAGAAAAAAAAGGAGAGCCTAGTGGGGAT
TGGCTTGATATTTTTTTATCGTTTGTGTTTAACAAAAAACAATCTTCCGATCTCAAAGAAACGCTCAATC
AAGAGCCAAGGCCTAATGTTGAACAAAATATAGCCACTACCCCCACCCCCATACAAGGCTTACCGCTTGA
AGCTAGGGATTTGCTTGATGAAAGGGGTGATTTTTCTAAATTCACTCTTGGTGATATGGAAATGTTGGAT
GTTGAGGGTGTCGCCGACATTGATCCTAATTACAAGTTCAACCAGTTATTGATTCACAATAACGCTCTGT
CTTCTATGCTAATGGGGAGTCATGGCAACATAGATCTTGAAAAAGTTTCATTGTTGTATGGGGATAATGG
TGGCCCTGAAGCTAGGCATGATTGGAACGCCACCGTTGGTTATAAAAACCAACAAGGCAACAATGTGGCC
ACACTCATCAATGCACATCTTAAAAACGGCAGTGGGTTAATCATAGCGGGTAATGAAAATGGGATTAACA
ACCCTAGCTTCTATCTCTACAAAAAAGACCAACTCACAGGCTTGGAACAAGCGTTGAGTCAAGAAGAGAT
CCAAAACAAACTAGGTTTCATGGAATTTCTTGCACAAAACAGCGCTAGACATGTTGGATTAAATAACTTG
AGCAAGGAAGAGAAAGAAAAGTTCCAAACTGAAATTGGAAATTTCCAAAAAGACCCTAAGGCTTATTTAG
ACACCCTAGGGAGTGATCACATTGCTTTTGTTTCTAAAAAAGACCAAAAGCATTTAGCTTTGGTTACTGA
GTTTGGCAATGGGGAATTGAGCTATACCCTCAAAGATTATGGGAAAAAACCAGATAGAGCTTTAGATAGG
GAGACAAAAACCACTCTTCAAGGTAACCTAAAAGATGATGGCGTGATGTTTGTCAATTATTCCAATTTCA
AATACACCAACGCCTCCAAGAGTCCTAATGAGGGTATAGGCGCTACGAATGGCGTTTCCCATTTGGAAGC
AAATTTTAGCAAGGTAGCTGTCTTTAATTTGCCTGATTTAAATGGTCTCGCTGTCTCTAGTTTTGCAAGG
CGGAATTTAGAGGATAAACTGGCCGCTAAAGGATTGTCCGGAAAAGAATCTAATAAGCTCATCAAAGACT
TTTTGAGCAGCAACAAGGAATTGCTTGAAAAAGTTTTAAACTTCAATAAAGCTGTAGCTGAAGCTAAAAA
TACAGGCAATTATGATGGGGTGAAAAAAGCTCAAAAAGATCTTGAAAAATCTATAAGGAAACGAGAGCGT
TTAGAGAAAGAAATAACGAAACAATTTGAGAGCAAGAGCGGCAACAAAAATAAAATGGAAGCAAAAGCTC
AAGCTAACAGCCAAAAAGATGAGATTTTTAAGCTTATCAATGAAGGGGCTTATAAGGAAGCAAGAATCAT
CGCTTACGCTCAGAATCTTAAAGGCATCAGGAGGGAATTGTCTGATAGAATGGGAAATATCAACAAGAAT
TTGAAAGACTTTAATCAATCTTTTGATGCGCTCAAAAGTGGTAAAAATAAGGATTTCAGCAAGGTAGAAG
AAACGCTAAAAGCCCTTAAAAGCTCGGTGAAAGATTTGAATATCAATCCAGAATGGATTTCAAAAGTTGA
AAACCTTAATGTAGCTTTGAATGAATTCAAAAATGGCAAAAATAAGGATTTCAGCAAGGTAACACAAGCA
AAAAGCGACCTTGAAAATTCCATTAAGGATGTGCACATCAATCAACAGATAACGGATAAAGTTGACAATC
TCAATCAGGCTGTATTAGTGGCTAAAGCGACAGGCGATTTCAGTAGGGTAGAGCAAGCGCTAGCCGGATT
CAAAAAATTCTTAACGGATCAAAAAAATGAAAATTTCAATGTTGGAAAAAATTCTGATCTACAATCCGTT
AAAAATGGTGTAAATGGAACCCTAGTCGGTAATGGATTATCTGTAACAGAAGCCACAACGCTCACCAAAA
AATTTTCGGACATTAAGAAAGAATTGAATGAGAAATTTGCAAATTTCAACAAAAATAGTAATGGACTCAA
AAACAGCGCAGAGCCCATTTACGCTCAAGTTAATAAAAAGAAAACAGGACAAGTAGCTAGCCCTGAAGAG
TCCATTTACACTCAAGTTGCTAAAGAGGTAAATGAAAAAATTAACCGACTCAACGAAAAAGCATCAGCAA
GTAAAGGAGTGGGCAATTTTAGTGGAGCAGGGCGATTAGATAGCCCTGAACCCATTTACGCTACGATTGA
TGATCTCGGCGGATCTTCCCCTTTGAAAAGGCATGCTAAAGTTGATGATCTCAGTAAGGTAGGGCTTTCA
AGGGAGCAAGAATTGACTCAGAAAATTGGCAATCTCAATCAGGCAGTGTCAGAAGCTAAAGCAGGTTCTT
TTGGCAACCTAGAACGAACGATGGATGGACTCAAAGATTCTACAAAAAAGAATGTTGTGAATCTATGGTT
TGAAGGTGCAAGAAAAGTGCCTATTAGTTTGCAAGCGAAATTGGACAATTACGCTACTAACAGCCACACA
CGCATTAATAGCAATGTCAAAAATGGAACAATCAATGAAAAAGCGACCATCATGCTAACGCAAAAAAACC
CTGAGTGGCTCAAGCTCGTGAATGATAAGATAGTTGCGCATAATGTGGGAAGCACTCCTTTGTCAGATTA
TGATAAAATTGGATTCAACCAAAAGAATATGAAAGATTACTCTGATTCGTTCAAGTTTTCCATCAAGTTG
AGTAATGCCGTAAAAAACATTAAGTCTGGCTTTGTGCAATGTTTAACCGATTGCATTTCTGCAGGATCTT
ACAGCCCAAAGAAAGCGGAACATGGAGTTACAAAAAGTGGTTTCCAGAAATCTTAA
 Primer design

Reference
(1) Delgado-Rosado G; Dominguez-Bello MG; Massey SE (2011). Positive selection on a bacterial oncoprotein associated with gastric cancer. Gut Pathog. 3:18. [PudMed:22078307] experimental
 
experimental experimental literature