SecReT4
Effector Protein ID: 189022344
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II01140
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]121650..122111 [-]
Producthypothetical protein
Effector typeProtein
DescriptonBPE123
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDB2SCT5
KEGG IDbmc:BAbS19_II01140
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 153 a.a.     [Download]
>gi|189022344|ref|YP_001932085.1| hypothetical protein BAbS19_II01140 [Brucella abortus S19]
MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAAASNGLERAVKAIRNERTDLTDASAKL
DARLAETQRVRREMDEAIEELNRLRKALSRDMRQARILAETPPPRQEKTPSAAEQPLPADKNALPVFVRR
AVKKATVELAGQA
-
Nucleotide Sequence: 462 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c122111-121650 Brucella abortus S19 chromosome 2, complete sequence
ATGAGCTTGTTGCTGGCTAACGTGCTTTCCACATTGATGGCTCTTGCCTCGCTTGCGGCTTTGATCGTGG
TGGGCCGCAAGGCCAATGAAACCATCAGGCTCGGCAAGGTGCTGGCGCTGCGCGTCGCCGCCGCGTCAAA
CGGTCTGGAGCGCGCCGTAAAGGCGATCCGCAACGAACGTACCGACCTTACCGACGCCAGCGCCAAGCTT
GACGCCCGCCTTGCCGAAACGCAGCGCGTGCGCCGTGAAATGGACGAGGCGATCGAGGAATTGAACCGGC
TGCGCAAGGCGCTCTCGCGCGATATGCGCCAGGCGCGCATCTTGGCCGAAACGCCGCCACCCCGGCAGGA
GAAAACCCCGTCCGCCGCAGAACAACCGCTCCCCGCAGACAAGAACGCGCTGCCCGTTTTCGTGCGCCGC
GCGGTCAAGAAGGCAACCGTTGAACTGGCGGGACAGGCATGA
 Primer design