SecReT4
Effector Protein ID: 189024189
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_I09680
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010742] [Browse all T4SS(s) in this replicon]
Location [Strand]1005977..1010638 [-]
Producthypothetical protein
Effector typeProtein
DescriptonBPE043
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDB2S5N6
KEGG IDbmc:BAbS19_I09680
PDB IDNA
Domain hit(s) vs Pfam Apolipoprotein [PF01442], Evalue: 9.7e-37, Aligned region: 325..529
Apolipoprotein [PF01442], Evalue: 9.7e-37, Aligned region: 533..728
Apolipoprotein [PF01442], Evalue: 9.7e-37, Aligned region: 856..984
Apolipoprotein [PF01442], Evalue: 9.7e-37, Aligned region: 992..1161
Apolipoprotein [PF01442], Evalue: 9.7e-37, Aligned region: 1212..1517
Protein Sequence: 1553 a.a.     [Download]
>gi|189024189|ref|YP_001934957.1| hypothetical protein BAbS19_I09680 [Brucella abortus S19]
MASKSKAQELDLEVEKALEQALDIDFGDDIDIDMDLGAFDEGFSIDDLEEQISRAAEELVAEQQAKAAEP
VGNEPVVKAASVITTASVIATPAAPPVPPVVKAASSAPAIAANTEHKPANVVAEPVSAQETAAKPAAAVA
TATPVATPVRTPANDDSRSDKAIAAAPRRITEHSSKLYWTTTAISVLWAAGGVAISKAINPEVFSSLQAT
KDFFTAPAGLGVVAGVALPIAMFWGFAQLVKRAQEMQDAARSMTDAALKLLQPEAVAGDRVSTLGQAVRR
EVAAMNEGIERTLARAVELETLVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAH
EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFA
NLLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFE
ARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGN
VLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAARTGDIQNAIDASASALNEVTDKHAAI
LTERTSALQQAMSSNVSLLDASFADHARSLEERTASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVL
ARTFDERIGSLQSLIAENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHN
DALAHVLDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFEGQTG
IIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDGFGESFSARLID
NLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTSETLASHSESFSASVADNLAGTETR
LVERADAIATRLGDIGSRITMELGSVEARIAQVTDTTAVTLEERTRELNAVLAARSQEITKILNDTAEPL
VQRLADSGRGLAQQLEEATHAATDRLRSENAALVNALASRTAETIAAVQQAKVGLSDNVSELIDRLAASN
GELGKLIDAATRNLADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADR
FDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVASAFQRAEGQTR
VSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSE
QINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPA
ASAEKPRGWVSDLLARASREEEEAAQPKVQPAATPRSPSHVVESLNSLSVDIARAIDHEASVELWDRYRR
GERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARNDRDNMVTQTYLTSDTGK
VYTMLAHASGRLR
-
Nucleotide Sequence: 4662 bp     [Download]
>gi|189023268|ref|NC_010742.1|:c1010638-1005977 Brucella abortus S19 chromosome 1, complete sequence
ATGGCTTCAAAATCCAAGGCACAGGAGCTCGACCTTGAGGTTGAAAAGGCGCTGGAACAGGCACTGGATA
TCGATTTCGGAGACGATATTGATATCGATATGGACTTGGGTGCGTTTGACGAAGGCTTCTCGATTGACGA
TCTGGAAGAGCAGATTTCCCGTGCCGCGGAAGAACTCGTCGCCGAACAGCAGGCGAAAGCCGCCGAGCCT
GTTGGAAACGAGCCGGTCGTCAAGGCCGCTTCGGTCATCACAACGGCTTCCGTGATTGCAACGCCTGCTG
CGCCTCCGGTGCCGCCTGTCGTCAAGGCGGCCTCCTCTGCTCCCGCTATAGCCGCCAATACCGAGCACAA
ACCTGCCAATGTAGTTGCCGAACCCGTTTCAGCACAGGAGACCGCGGCCAAGCCTGCCGCTGCGGTCGCC
ACTGCAACGCCGGTCGCCACGCCTGTTCGTACACCAGCAAATGACGATTCGCGCAGCGACAAGGCCATCG
CCGCCGCGCCGCGCCGCATCACCGAGCATTCCTCTAAGCTTTACTGGACCACGACCGCAATCAGCGTGCT
GTGGGCGGCTGGCGGCGTTGCTATCAGCAAGGCGATCAATCCGGAAGTCTTCTCCAGCCTGCAAGCCACC
AAAGATTTCTTCACCGCACCCGCCGGACTTGGTGTGGTTGCCGGTGTGGCGCTGCCGATCGCGATGTTCT
GGGGCTTCGCACAACTCGTCAAGCGTGCTCAGGAAATGCAGGACGCTGCGCGCAGCATGACCGATGCCGC
GCTCAAACTGCTTCAGCCGGAAGCTGTCGCGGGTGATCGCGTCTCCACGCTGGGCCAGGCCGTGCGCCGC
GAAGTTGCAGCCATGAACGAAGGCATCGAACGCACACTTGCGCGCGCGGTGGAGCTGGAAACGCTCGTCC
AATCCGAGGTCAACCAGCTTGAGCGCGCCTATAGCGACAATGAGGTGCGTATTCGCTCGCTCGTCAGCGA
TCTTGGCAATGAGCGTGAAGCAGTTGTCAGCCATGCCGAGCGTGTTCGTTCGTCCATCTCTGGTGCGCAT
GAACAGCTTAGGGAAGAATTATCAAGTGCATCCAATATCATACGCGACAATGTTCTGTCCGCGTCTCAGC
AGCTCAGCGCGCTCTTGGGCGATTCTGGCGAGCGCCTCATCAGCAATATCAACGAAAGCGGCGGCGCTAT
TGCCGATGCAATCGAGAAGCGCACCGGCGATATTGGAAATCGCATCACCACCTCCGGCGAAGCTTTTGCC
AATCTGCTCGATACCCGCATCGCAACGCTTGACGAACAGTCGCGCACGATCTCCGGGAAGTTGACTCAGG
CTCTGGACGAGCGCACCACCGGCATTGCAAATGTGCTTGGCAGCGCGACCCAGACCATGGTGAGCGAGTT
CGACACGCGCCTTGCCAATCTGGAAAACACCCTTTCCGACCGTGGCCGCTCGTTGCTGGCAGAGTTTGAG
GCGCGCGCCCATGCGCTTGACAACAGCACCGAAAAGCTGAATGCGGCGTTGGAAACCCGTTCGCGCCAGA
TCAACGAAAACCTCATTGCCCGCACCCGTGAAATCGCCGAAACCTTCTCGGGCGGCCGCAATTCGCTGGG
CGCGATGGTGGACGACATCAAGGTGAAGATCGGCGACGATCTGACCTCGATCAGCGAAAGCGTCGGCAAT
GTTCTGATCGATAAGGCAGCAGCCTTCGAGGGCAAGCTGGCCGAAAGCCGCGATCTTCTGGCGGCAACGC
TGGAAGGCGAAACAGAGCGCGTTTCCTCGGTCATTCGCGGCCATGCGGATACGCTTGCCGCGCGCACCGG
CGATATCCAGAACGCTATCGATGCAAGCGCCTCAGCGCTCAATGAAGTCACAGACAAGCACGCGGCAATC
TTGACCGAGCGCACCAGTGCGCTGCAGCAGGCCATGTCCAGCAATGTTTCCCTGCTGGATGCGAGCTTCG
CAGACCATGCCCGTTCACTTGAAGAGCGCACTGCGTCCCTGCACAATGTCATTGCAGGAAATCAGGCAAT
GCTGGCTCAGCTCATGGATGAGCGTGCGGCTGCAATGCGCGAGAATTTCAACGAAAATCGTGAAGTGCTG
GCCCGCACCTTCGATGAACGTATTGGCAGCCTTCAGTCGCTTATCGCGGAAAACCAGAGCGCCCTTGAGC
GTATTCTGGATGAGCGCGCGCGCAATATGGCGGAATCCCTCGGCGCTGGCCGCGATGCCTTTGAAACGGC
ACTGGGCGAGCATGTCCGCACGGTCGAGGAACGCACAAGCGGCTTGCAAGCCGTTCTGAACAACCACAAT
GATGCGCTGGCGCATGTTCTGGATGGACATGAGCAGACCATTGAAACGCGGGCCGCTGAAATCCGCTCCA
CCCTGACGGACAGCACGGCTTCGCTCAGCCAGACCTTGCAGGATCATGGCGAGATTCTGGAGCAGCGCAC
CACGAGCCTGCAAAACGCCATCGCCAACAGCAGCGCCGCCATCAGCAGCGCCTTTGAGGGCCAGACCGGC
ATTATCGAAGAACGTACCGAGACCATGGAAAAGGCTCTTTCCATCGGCGTGGACAATGTGCGCCGCGCAC
TGGAACAAAGTGCAGGCGTGGTCGCCGGAAAGCTGCGTGAAAAGATCGGTGAAGCTGCCAGCACACTTGC
CGCTGAGGCCGCCAAAGCCGGCGAAGCCCTCGACGGCTTTGGCGAAAGCTTCAGTGCTCGGCTCATCGAT
AATCTTTCCGGCACCGAAGCCCGCCTCGGCGAACGCGCGGATGCTATTGCCGGACGCCTTGGCGACATTG
AAAGCCGCCTTACCGACGAGCTTGGGACCATTGAGGCACGCATTGCCGATACGGCCGCCAAAACAAGCGA
AACGCTTGCCAGCCACAGCGAATCCTTCTCGGCCAGCGTTGCCGACAATCTCGCTGGCACAGAAACACGT
CTTGTCGAGCGTGCGGATGCGATCGCAACCCGTCTTGGCGATATCGGCTCGCGCATCACGATGGAGCTCG
GCTCCGTCGAGGCTCGCATTGCGCAGGTGACGGATACGACGGCGGTTACGCTGGAAGAACGCACCCGTGA
GCTCAATGCCGTCCTCGCCGCTCGCTCGCAGGAAATCACCAAAATCCTCAACGATACGGCCGAACCGCTG
GTTCAGCGCCTTGCCGATAGTGGCCGTGGCCTTGCCCAGCAGCTTGAAGAAGCAACCCATGCAGCAACTG
ATCGCCTGCGTTCGGAAAATGCGGCGCTCGTCAATGCGCTGGCAAGCCGCACGGCGGAAACCATCGCTGC
GGTCCAGCAGGCAAAGGTCGGGCTTTCCGACAATGTCAGCGAACTCATTGACCGCCTCGCCGCTTCCAAT
GGTGAGCTTGGCAAGCTGATTGATGCCGCCACGCGCAACCTTGCCGATATCGATGGGCGTCTGGTGGACT
CTACGACGAGCTTTGTGGAAAACACGAACCGCGCGGCGCAGATGTTCCAGGCTTCAACTGGCCTCATCGA
CAGCAATCTCGGTACGCTTCGTACGCTATCCGACAATACCTTGTCGCAAATCGCCGATATTGCCGACCGC
TTCGATGAACATGGCAAGGTTCTGTCTTCGGCATCCGATATGATCAATTCCGCACAGAACGGCCTCGTCA
GCACACTTGAGGAGCGTCATCAGGCGCTCGACAAGCTGGCTTCCGGTCTGGTGGAAAAATCGGAAGGCGT
CGAAAAGCTCATGCAATCCTTCGAGGCTCTGGTTGCCTCGGCCTTCCAGCGCGCCGAAGGCCAGACCCGC
GTTTCGGCGGAAAAGATGCGCGAGAGCGTTTCGGATATCGTCGAACAGGCCGCACAGAAGTTCTCGGCAG
CGACCGACGAAATTCGCCGCACGGCAAGCGAAATCCGCGCCGAACTCGATACAACGCGCGGCGAACTGAA
GCGTGGCGTTCTCGACATGCCTGCCGAAGCGAAGGAAACGACGACCGCCATGCGCAAGGCCGTGAGCGAG
CAGATCAACGCGCTCAAGGAACTTGCTGAAATTGTCAACAAGTCGGGCCGTCTGGTTGATGTGGGTGAAG
GCCGTGCCGACCGCCCTGTGTCGCGCCCCGCAGCATCTCGCCCTGCTCCTGTTCGGGCACCGATCGCGCC
TCTGGCACAGACAGATGTTGCAGTCCGGTCGCGTCCGGTGGAAGCGCCGAACCAAAAGCCTGCTCCAGCG
GCATCTGCGGAAAAGCCGCGCGGTTGGGTTTCCGATCTTCTTGCCCGCGCCTCACGTGAGGAAGAAGAAG
CCGCGCAGCCCAAGGTGCAGCCGGCCGCAACGCCGCGTTCTCCGAGCCATGTGGTTGAATCGCTCAACTC
GCTTTCCGTCGATATCGCCCGTGCTATCGACCACGAAGCTTCGGTTGAGCTTTGGGACCGTTATCGCCGC
GGTGAGCGCAATGTTTTCACCCGCCGTCTCTATACGCTGAAAGGTCAGCAGACCTTTGACGATATCAAGC
GCAAGTATCAGACCGATGGTGAATTCCGCCGCGCCGTAGATCGTTACATGAACGATTTCCAGCGTCTTCT
CGAAGACGTTGCCCGCAATGACCGCGATAATATGGTGACGCAGACTTACCTGACATCCGACACAGGCAAG
GTTTACACCATGCTCGCCCATGCAAGCGGACGCCTTCGGTAG
 Primer design