SecReT4
Effector Protein ID: 189024202
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_I09810
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010742] [Browse all T4SS(s) in this replicon]
Location [Strand]1019753..1021009 [-]
ProductProline-rich extensin
Effector typeProtein
DescriptonVceC
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDB2S5P9
KEGG IDbmc:BAbS19_I09810
PDB IDNA
Domain hit(s) vs Pfam FliO [PF04347], Evalue: 1.3e-07, Aligned region: 37..94
Protein Sequence: 418 a.a.     [Download]
>gi|189024202|ref|YP_001934970.1| Proline-rich extensin [Brucella abortus S19]
MKEWLSGIIGESAANIVGFVLIFAIILGGIFVVLGIIRRFSGGTFVSSGRMRQPRLSVMDAAAVDSRRKL
VLIRRDDVEHLLLIGGPTDVVVEQNIVLESRAGTHAPGTHALGTHAQSSRIEPEHIERFRQHEVLANEKT
ERPALSVQSQPGDEREETIQLSSAIAAPVYRKPEPPKAENVRPAPSEPAPMRAPQPPVTPPPAAPRPEAP
ASQVSEPHPRPASNYPSQPRTVLPPRPAPSAAPNSVRAHPAYPLSQVSRGVVSSTSNIQAATVASAATAN
LGSIVPERESAAPAKPAAPAPNQPERSERPERPERPQQRIEPVVPFVAQEVRQPESADDDLDDLGGTLHD
AIMADLGSNAGKDENMEELDTASLEDELLSSLDISPTDEQPEDAKAEETIEDEMEKLLGELTKGETRN
-
Nucleotide Sequence: 1257 bp     [Download]
>gi|189023268|ref|NC_010742.1|:c1021009-1019753 Brucella abortus S19 chromosome 1, complete sequence
ATGAAGGAATGGCTCAGCGGCATCATCGGTGAAAGCGCGGCTAATATTGTCGGCTTTGTGCTTATATTTG
CAATCATCCTTGGCGGAATTTTTGTTGTTCTCGGCATCATTCGCCGTTTCAGCGGCGGCACATTTGTATC
CAGCGGGCGCATGCGCCAGCCCCGCCTTTCGGTGATGGATGCCGCCGCGGTAGACAGCCGGCGCAAGCTG
GTTCTGATCCGCCGCGACGATGTGGAACATCTGCTCCTGATCGGTGGCCCGACCGATGTGGTTGTCGAAC
AGAATATCGTTCTGGAATCGCGCGCTGGCACCCATGCCCCTGGAACTCATGCCCTTGGTACCCACGCACA
GAGCTCGCGTATCGAACCGGAACATATTGAACGCTTCCGCCAGCACGAAGTGCTTGCCAATGAGAAGACG
GAACGGCCTGCCCTTTCCGTCCAGTCCCAGCCCGGAGACGAACGCGAGGAAACTATTCAGCTAAGCTCGG
CCATCGCGGCGCCCGTCTATCGCAAGCCGGAGCCGCCGAAGGCTGAGAACGTCCGGCCCGCGCCCTCCGA
ACCCGCACCAATGCGGGCACCGCAGCCTCCCGTGACGCCACCGCCAGCCGCGCCGCGCCCTGAAGCGCCT
GCGTCGCAGGTTTCCGAGCCGCATCCGCGCCCAGCTTCAAATTACCCGTCACAGCCGCGCACGGTTCTTC
CCCCGCGCCCCGCGCCATCGGCTGCCCCAAACAGCGTTCGCGCGCATCCAGCCTATCCGCTGAGCCAGGT
TTCGCGCGGCGTGGTAAGTTCCACATCAAATATCCAGGCAGCCACGGTTGCATCGGCCGCGACAGCAAAT
CTGGGCAGCATTGTGCCCGAACGCGAATCTGCCGCTCCGGCAAAACCCGCAGCGCCCGCGCCGAATCAGC
CGGAACGTTCAGAGCGTCCAGAACGCCCGGAACGCCCACAACAACGCATCGAGCCGGTTGTTCCCTTTGT
CGCCCAGGAAGTCAGGCAGCCCGAAAGCGCAGATGACGATCTGGATGACCTTGGCGGCACATTGCATGAT
GCCATTATGGCCGATCTTGGCAGCAATGCCGGTAAAGATGAAAATATGGAGGAGTTGGACACGGCTTCGC
TGGAAGACGAACTACTCAGCTCGCTTGATATTTCACCTACCGATGAACAGCCGGAAGATGCCAAGGCCGA
AGAAACCATCGAAGACGAAATGGAAAAGCTGCTTGGTGAGTTGACCAAGGGAGAAACCCGCAATTAG
 Primer design