SecReT4
Effector Protein ID: 189024400
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_I11890
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010742] [Browse all T4SS(s) in this replicon]
Location [Strand]1238524..1239252 [-]
ProductRhomboid-like protein
Effector typeProtein
DescriptonBPE275
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDB2S697
KEGG IDbmc:BAbS19_I11890
PDB IDNA
Domain hit(s) vs Pfam Rhomboid [PF01694], Evalue: 2e-25, Aligned region: 73..229
Protein Sequence: 242 a.a.     [Download]
>gi|189024400|ref|YP_001935168.1| Rhomboid-like protein [Brucella abortus S19]
MSIPQPEMRGTGGREPIFNIPGVVIALIGLCVAVYVYQNYILSERQDFEFMMNFALIPARFSMASGFVDP
AVIFTFISYSFMHGSFAHIAVNMIWLAAFGSPLAGRIGAVRMILFWVFTSVVAGLTHYALHPESLSPLVG
ASGAISGMMGAAARYGFRRVGYGRRSEFAGPVLPIGLTLTLKPVLIFVGVWFLINIVTGLYSTGGADFSS
IAWEAHIGGFIAGFFGIPLMDRPRSYDAVLRR
-
Nucleotide Sequence: 729 bp     [Download]
>gi|189023268|ref|NC_010742.1|:c1239252-1238524 Brucella abortus S19 chromosome 1, complete sequence
ATGAGCATTCCCCAGCCGGAAATGCGCGGCACAGGCGGCCGCGAGCCGATCTTCAATATTCCGGGTGTCG
TGATTGCTCTGATCGGGTTGTGTGTCGCGGTCTATGTCTATCAGAATTATATTCTGAGCGAGCGGCAGGA
TTTTGAGTTCATGATGAACTTTGCGCTGATCCCGGCGCGCTTTTCGATGGCGAGCGGCTTTGTTGATCCG
GCGGTGATTTTTACGTTTATCAGCTATTCCTTCATGCATGGCAGTTTTGCGCATATTGCCGTCAATATGA
TCTGGCTTGCCGCATTCGGCTCGCCGCTGGCCGGGCGAATCGGCGCGGTCCGGATGATCCTATTCTGGGT
TTTCACGTCGGTCGTCGCGGGGCTTACGCATTACGCACTCCATCCCGAAAGCCTTTCGCCGCTGGTGGGT
GCGTCGGGCGCGATTTCGGGCATGATGGGAGCTGCCGCCCGTTATGGTTTTCGGCGTGTCGGCTATGGCC
GGCGCTCGGAATTTGCCGGGCCGGTGCTTCCCATCGGGCTGACGCTGACGCTCAAGCCCGTCCTCATTTT
TGTCGGCGTCTGGTTTCTCATCAATATCGTCACCGGCCTTTATTCCACTGGCGGCGCTGACTTTTCCAGC
ATTGCCTGGGAGGCGCATATAGGCGGCTTCATTGCCGGGTTTTTCGGGATTCCACTGATGGACCGCCCGC
GCAGCTATGATGCCGTTTTGAGGCGATAG
 Primer design