SecReT4
Effector Protein ID: 189024403
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_I11920
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010742] [Browse all T4SS(s) in this replicon]
Location [Strand]1241213..1241740 [-]
Producttransferase
Effector typeProtein
DescriptonRicA
T4CP requirementT4CP Indepedent
Target/EffectionRicA was demonstrated to interact with human small GTPase Rab2 involved in trafficking
UniProt IDB2S6A0
KEGG IDbmc:BAbS19_I11920
PDB IDNA
Domain hit(s) vs Pfam Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 17..47
Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 75..105
Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 90..124
Protein Sequence: 175 a.a.     [Download]
>gi|189024403|ref|YP_001935171.1| transferase [Brucella abortus S19]
MPIYAYNGHKPQFADRESNWIAPDATLIGKVVVGENAGFWFGAVLRGDNEPITIGADTNVQEQTIMHTDI
GFPLTIGAGCTIGHRAILHGCTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKEGMEIPDNSLVVGSPA
RVLRQLDDAAVEKLRASAKHYVERGHSFMRGMEPA
-
Nucleotide Sequence: 528 bp     [Download]
>gi|189023268|ref|NC_010742.1|:c1241740-1241213 Brucella abortus S19 chromosome 1, complete sequence
ATGCCGATCTATGCATATAACGGGCACAAGCCGCAGTTTGCGGACCGCGAGAGCAACTGGATTGCACCGG
ATGCGACGCTGATCGGCAAGGTGGTCGTGGGCGAGAATGCGGGTTTCTGGTTCGGCGCGGTGTTGCGCGG
CGATAATGAGCCAATCACTATCGGTGCCGATACCAATGTGCAGGAACAGACGATCATGCACACCGATATC
GGCTTTCCGCTGACCATCGGTGCGGGCTGCACTATCGGGCACCGTGCGATTCTCCATGGCTGCACGATTG
GCGAGAATACTCTTATCGGCATGGGCGCGATTGTGCTCAATGGCGCGAAGGTCGGCAAGAATTGCCTTAT
CGGGGCGGGAACATTGGTGAAAGAAGGGATGGAAATCCCTGATAATTCGCTTGTTGTCGGCTCTCCCGCG
CGTGTCCTGCGCCAGCTTGACGATGCTGCCGTTGAAAAGCTGCGGGCCTCTGCAAAGCATTATGTGGAGA
GGGGACATTCCTTCATGCGCGGCATGGAGCCTGCCTGA
 Primer design