SecReT4
Effector Protein ID: 189024735
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_I15450
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010742] [Browse all T4SS(s) in this replicon]
Location [Strand]1597939..1598256 [+]
Producthypothetical protein
Effector typeProtein
DescriptonVceA
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDB2S782
KEGG IDbmc:BAbS19_I15450
PDB IDNA
Domain hit(s) vs Pfam PepSY_2 [PF13670], Evalue: 1.6e-21, Aligned region: 5..85
Protein Sequence: 105 a.a.     [Download]
>gi|189024735|ref|YP_001935503.1| hypothetical protein BAbS19_I15450 [Brucella abortus S19]
MKIIITAAALVALSATGAMAQKTQCDAKPLDEKSIDALVQLSNEFTWKISEMEIDDGCYELHVTDENGNV
LKVKVDPETMKVVAGKVKRYGDGAPAKDKGHAPKN
-
Nucleotide Sequence: 318 bp     [Download]
>gi|189023268|ref|NC_010742.1|:1597939-1598256 Brucella abortus S19 chromosome 1, complete sequence
ATGAAAATCATCATCACGGCAGCAGCCCTGGTTGCACTGTCCGCCACGGGCGCAATGGCCCAAAAAACCC
AATGCGATGCAAAGCCGCTGGATGAGAAGTCCATCGATGCCTTGGTACAGTTGTCGAACGAATTTACGTG
GAAAATTTCCGAAATGGAGATTGACGACGGCTGTTATGAGCTGCACGTTACCGATGAAAACGGCAATGTC
CTCAAGGTCAAGGTGGACCCTGAAACGATGAAGGTGGTTGCTGGCAAAGTAAAGCGGTACGGCGATGGCG
CTCCGGCCAAGGACAAGGGCCACGCGCCCAAGAACTAG
 Primer design