SecReT4
Effector Protein ID: 189025068
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_I18800
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010742] [Browse all T4SS(s) in this replicon]
Location [Strand]1942823..1943284 [-]
ProductcAMP-dependent protein kinase
Effector typeProtein
DescriptonBPE005
T4CP requirementT4CP Indepedent
Target/EffectionUnknown
UniProt IDB2S8Q8
KEGG IDbmc:BAbS19_I18800
PDB IDNA
Domain hit(s) vs Pfam cNMP_binding [PF00027], Evalue: 9.8e-21, Aligned region: 35..122
Protein Sequence: 153 a.a.     [Download]
>gi|189025068|ref|YP_001935836.1| cAMP-dependent protein kinase [Brucella abortus S19]
MALDDDIRILGTVGLFESFTPEQLRLLAFGAERLVLRAGRELFREGQSADCAYIIVTGTITLFHEGDEGR
VTIRPVGPGAILGEMALIAQTTRLTGAVADVETEVIRISRSIFRRILEEYPEVAAALHAHISRNLVELIG
QIEQVAPRLANRD
-
Nucleotide Sequence: 462 bp     [Download]
>gi|189023268|ref|NC_010742.1|:c1943284-1942823 Brucella abortus S19 chromosome 1, complete sequence
ATGGCGCTAGACGACGATATTCGCATTCTCGGCACGGTGGGCCTGTTCGAGTCTTTCACGCCCGAACAGT
TGCGCCTGCTTGCCTTCGGTGCGGAGCGGCTTGTCCTGCGTGCGGGACGCGAGCTTTTCCGCGAGGGCCA
GAGTGCCGATTGCGCCTATATCATCGTTACCGGCACGATTACCCTGTTTCATGAAGGTGATGAAGGGCGG
GTCACGATCCGCCCTGTCGGCCCCGGCGCGATATTGGGGGAAATGGCGCTCATCGCCCAGACCACTCGTC
TCACCGGCGCGGTGGCGGATGTGGAAACCGAAGTCATCCGCATCAGCCGCTCCATCTTCCGGCGCATTCT
GGAAGAATACCCGGAAGTGGCCGCCGCGCTTCATGCGCATATCAGCCGCAATCTTGTCGAGCTTATCGGC
CAGATCGAGCAGGTCGCGCCGCGGCTTGCAAACCGCGACTGA
 Primer design