SecReT4
Effector Protein ID: 190404458
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p115
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]146513..147466 [+]
Productrcorf114
Effector typeProtein
DescriptonVirF
T4CP requirementT4CP Depedent
Target/EffectionVirF may be involved in targeted proteolysis of proteins, such as certain Virulence effector proteins, that must be stripped from T-strands prior to or during T-DNA integration.
UniProt IDA8W0G3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 317 a.a.     [Download]
>gi|190404458|ref|YP_001961089.1| rcorf114 [Agrobacterium rhizogenes]
MELLMPSSSQRTPPRESESARVKSDPASPNRNLPSDVLAKVATYVPTQDVVETARDLGNLERTGSAGREA
LRRGPIGIYHARVKRIGTSAKAVFDTIIPGEQLPDWQVNRPSETARTRAVGPLLKFQSEAGKARFTTNIL
NLPQPDQCDAILSVIKHLDDLGEVNKTRLIERSIEILQLDPPLTWNQGQKCPAADVLVQGEKHLNDDQKT
RVQHERNNRPELLRLFRRAVADFEIEKNMAAHPRRYQDAKEPEVKPIDEVIDIIERYSRSVVTRGPNAIG
LLTAHESFVKNVGDAYTRTRAEFDSSSRDRDRSALSR
-
Nucleotide Sequence: 954 bp     [Download]
>gi|190404344|ref|NC_010841.1|:146513-147466 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGGAGCTTCTCATGCCGTCCAGCAGCCAACGAACACCTCCCCGAGAATCTGAGTCTGCTCGGGTGAAGA
GTGATCCTGCGTCACCAAACCGAAACCTACCTTCCGATGTACTTGCAAAAGTTGCTACCTACGTTCCAAC
CCAGGATGTGGTCGAAACCGCACGAGATCTCGGAAATCTAGAGCGAACTGGCTCCGCAGGTCGCGAAGCT
TTACGTCGAGGCCCTATCGGAATTTATCACGCTCGCGTGAAAAGGATTGGTACATCGGCAAAAGCAGTCT
TCGATACAATCATCCCTGGGGAGCAATTGCCTGATTGGCAGGTGAACCGGCCATCTGAAACGGCAAGAAC
GCGGGCGGTAGGACCACTTCTGAAGTTTCAATCTGAGGCTGGAAAAGCACGATTCACAACCAACATCCTG
AACCTCCCTCAGCCTGATCAGTGCGACGCAATTCTGAGCGTGATAAAGCATCTGGACGATCTTGGGGAAG
TCAATAAGACGCGCTTAATCGAACGTTCGATCGAAATCTTGCAGCTTGATCCCCCTCTTACTTGGAACCA
GGGTCAGAAATGCCCCGCCGCAGACGTATTGGTCCAGGGCGAGAAGCACTTAAACGACGACCAAAAAACT
CGGGTACAACACGAGAGGAACAATCGCCCGGAGCTGCTGCGCCTGTTCCGCCGGGCTGTCGCAGACTTTG
AGATTGAAAAAAACATGGCGGCGCATCCCCGCAGGTATCAAGACGCGAAAGAACCGGAGGTGAAACCTAT
CGACGAGGTGATTGACATAATCGAAAGATATAGTCGATCGGTCGTGACGAGAGGGCCAAATGCTATCGGC
CTTCTGACGGCACACGAGAGTTTCGTCAAGAACGTCGGTGATGCCTACACCCGTACGCGCGCCGAATTCG
ATTCATCCTCCCGCGATCGGGACAGATCGGCATTGTCACGGTAA
 Primer design

Reference
(1) Hodges LD; Lee LY; McNett H; Gelvin SB; Ream W (2009). The Agrobacterium rhizogenes GALLS gene encodes two secreted proteins required for genetic transformation of plants. J Bacteriol. 191(1):355-64. [PudMed:18952790] experimental
 
experimental experimental literature