SecReT4
Effector Protein ID: 190404482
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p139
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]171300..172646 [+]
Producttype IV secretion system T-DNA border endonuclease VirD2
Effector typeProtein
DescriptonVirD2
T4CP requirementT4CP Depedent
Target/EffectionVirD2 is an endonuclease that nicks the T-DNA region of Ti-/Ri-plasmids at border repeat sequences flanking T-DNA. During T-DNA processing, VirD2 covalently attaches to the 5' end of the resulting T-strand. VirD2 serves as a "pilot protein" to lead T-strands through the T4SS and into the host cell. Once in the host, VirD2 probably plays a major role in targeting T-strands to the nucleus
UniProt IDA8W0J2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Relaxase [PF03432], Evalue: 3.1e-32, Aligned region: 16..218
Protein Sequence: 448 a.a.     [Download]
>gi|190404482|ref|YP_001961113.1| rcorf138 [Agrobacterium rhizogenes]
MPDRSQVIIRIVPGGGTKTLQQIINQLEYLSRKGKLELQRSARHLDTFVPPDEIRELALSWVQETGTYHE
SRPDEERQQELTTHIIVSFPAGTSQVAAYAASREWAAEMFGSGAGGGRYNYLTAFHIDRDHPHLHVVVNR
RELLGHGWLKISRRHPQLNYDALRITMAEISLRHGVVLEATSRAERGISERPMTFAQYRRLERQQANQIR
FEDIDFEEFSPGGNDGEPDQSFNSSYGSLPQNVSENLRRNGGLQSVSEVRSRALIGSNGNGVTPDRVSSG
NDSRSQSGSDKAFVDDGNLRNGPLTIAGDGQDLEGRSGMHRLATEPVTHTTSEDDVRQRPHRKRPRGDEE
EQSGAKLTRVDGIRTGVTISAVPVAQDDPITSPIQPPGSNPLDDPGQTNIATDALPPTADRRQQGEPNSK
RPRDDDAEPSIRKRSRDGRSQGDEGNRR
-
Nucleotide Sequence: 1347 bp     [Download]
>gi|190404344|ref|NC_010841.1|:171300-172646 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGCCCGATCGGTCTCAAGTCATCATCCGCATTGTGCCGGGAGGTGGGACGAAGACCCTCCAACAGATTA
TCAACCAGTTGGAGTATCTATCTCGGAAGGGCAAGTTGGAGCTGCAGCGTTCGGCCCGACATCTCGATAC
TTTCGTACCACCGGATGAAATCCGCGAACTCGCCCTAAGCTGGGTTCAAGAAACCGGGACTTATCACGAA
AGTCGGCCAGACGAGGAAAGGCAACAGGAGTTGACGACCCACATTATTGTAAGCTTCCCTGCCGGTACAA
GTCAGGTAGCAGCTTATGCAGCGAGCCGGGAGTGGGCAGCCGAGATGTTTGGGTCAGGCGCAGGGGGAGG
CCGATACAACTATCTTACAGCCTTTCACATCGATCGCGATCACCCACATCTGCATGTGGTCGTTAATCGT
CGCGAACTTTTGGGGCACGGCTGGCTGAAAATATCCCGGCGCCACCCCCAACTGAATTATGACGCCTTGC
GCATTACAATGGCCGAGATTTCACTTCGTCATGGCGTCGTCCTCGAGGCGACGAGCCGAGCTGAGCGCGG
CATCTCGGAGCGGCCGATGACTTTTGCCCAGTATCGACGCCTGGAGCGGCAGCAGGCCAATCAAATTCGT
TTCGAGGATATTGATTTCGAAGAATTCTCGCCTGGGGGAAACGACGGAGAACCGGATCAATCTTTTAATT
CTTCGTACGGTTCGCTGCCTCAAAACGTGTCAGAAAACTTGCGACGAAACGGCGGTCTGCAATCGGTGTC
TGAAGTACGTTCCCGGGCACTGATCGGATCGAACGGCAACGGTGTCACGCCCGATCGTGTATCATCTGGA
AACGATTCCCGTTCTCAATCCGGCAGCGATAAAGCCTTTGTGGACGATGGCAACTTGAGGAACGGCCCTC
TCACCATCGCCGGAGACGGCCAGGATCTTGAAGGCCGTTCTGGCATGCATCGTTTGGCAACCGAACCCGT
CACGCACACAACAAGCGAAGATGATGTTCGGCAACGGCCTCATCGAAAACGGCCTCGCGGTGATGAGGAA
GAGCAGAGCGGCGCAAAACTGACCAGGGTAGACGGAATTCGGACGGGAGTGACAATCAGCGCCGTACCGG
TTGCCCAGGACGATCCGATTACATCGCCGATCCAGCCCCCTGGATCAAATCCGTTGGATGACCCGGGGCA
GACCAACATCGCTACGGACGCATTGCCTCCGACAGCCGATCGCCGGCAGCAGGGAGAGCCAAATTCTAAG
CGTCCTCGTGATGATGACGCCGAGCCGAGCATTCGTAAGCGGTCAAGGGACGGGCGCAGCCAAGGGGATG
AGGGAAACAGAAGGTAG
 Primer design

Reference
(1) Hodges LD; Lee LY; McNett H; Gelvin SB; Ream W (2009). The Agrobacterium rhizogenes GALLS gene encodes two secreted proteins required for genetic transformation of plants. J Bacteriol. 191(1):355-64. [PudMed:18952790] experimental
 
experimental experimental literature