SecReT4
Effector Protein ID: 190404485
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p142
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]177650..180157 [+]
Productrcorf141
Effector typeProtein
DescriptonVirD5
T4CP requirementT4CP Depedent
Target/EffectionVirD5 interacts with and stabilizes VirF in plants.
UniProt IDA8W0J6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Agro_virD5 [PF04730], Evalue: 0, Aligned region: 63..835
Protein Sequence: 835 a.a.     [Download]
>gi|190404485|ref|YP_001961116.1| rcorf141 [Agrobacterium rhizogenes]
MKPSGSSKTGYAGSARSSPQVRAGVTPVLHPKEPWNRFACSPSDGQMDHRENLSAQFAYDGMRLGAAERS
AYETWDRADRPSWKDLILSARLNAIDSFAWNVDVGESTSSTFVYDGVPLAEGERHAYEEWVEPGQPSWQQ
LVVNARIEELNTSAAIPNECSPLQEEFRSEAPKRKRTSSIGQKNGFPEPFEFDGMRLGSPEREAYENWSK
PQPPSWKDLIVDARLDAIDTSTWLNESNDTSVFEYEGVPLGEGERLAYEKWLKPAQPGWEDLVVDARVAE
LHQSAPTWCEHQPGNDVSSNESGRISGVPINAEQVSRAFFVYDGVALGAAERAAHDRWSRPDRPTWEDLI
IVARQAAIEGGAVSNGMIGKTSSSVFLYEGMLLGDAERQAYGRWRQLAQPRWQNLVVNARLAELDPAAWI
PDEHDPSEDGGATGLLSQASTTNKSRLSLGDQPEARSPSLAREPAQQPTHVQNLTCAQLEARRALYFGPS
GRDADQTASIADSNRLDEVSKVKRLGAKSRRGAKATAYDVISSAERLSSHEGCLTVQSTQPEKAACSRSD
NIGTYGSRKNERARLATETGKYESEHIFGFKVVHDTLRSTKEGRRLERPMPAYLECKELHRQHVGTGRGR
TRLVGRGWPDDASYRSDQRATLSDPVASTEGATASNGYQLNQLGYAHQLANDGLQSETPDGVIMPLQVAT
TSYNYTVSRDPVLSPPSKEQAPELLHLGPRGQTEAVLARETALTGRWPTREREQQVYREFLALYDVKKDL
EAKTLGLRKKKAALVSALNRTAASIGTSPLKAQSSSAEVEKATHEFDERRVYDPRDRGRDKALQR
-
Nucleotide Sequence: 2508 bp     [Download]
>gi|190404344|ref|NC_010841.1|:177650-180157 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGAAACCGTCGGGAAGCTCAAAAACTGGATACGCCGGGTCGGCTAGATCCTCGCCCCAGGTTCGCGCAG
GGGTTACGCCTGTCCTTCATCCCAAAGAGCCTTGGAACCGTTTTGCTTGCTCCCCATCTGACGGCCAAAT
GGATCACCGGGAAAATTTATCTGCGCAATTCGCTTACGATGGAATGAGACTGGGCGCAGCCGAGCGGTCC
GCGTACGAGACATGGGATAGAGCGGACCGGCCGAGTTGGAAAGACCTGATACTGAGCGCTCGCCTGAACG
CGATTGACAGTTTCGCTTGGAATGTCGATGTCGGAGAAAGTACCTCTTCAACTTTTGTTTATGATGGTGT
TCCTCTGGCGGAAGGGGAACGGCATGCCTACGAGGAATGGGTGGAGCCGGGACAGCCCAGTTGGCAACAA
CTCGTTGTGAACGCGCGTATTGAAGAGCTAAACACCTCTGCTGCAATTCCGAATGAGTGTAGTCCCCTTC
AAGAGGAATTCCGATCGGAGGCGCCTAAGCGTAAGCGGACAAGCTCCATTGGTCAAAAGAACGGTTTCCC
TGAACCATTCGAATTTGATGGGATGAGACTCGGCTCGCCTGAGCGCGAAGCATATGAGAATTGGAGTAAA
CCGCAACCGCCATCCTGGAAAGACCTGATAGTTGACGCCCGTCTTGACGCAATCGACACCTCCACCTGGC
TCAACGAATCAAATGACACCTCGGTCTTCGAGTACGAAGGCGTCCCGCTTGGGGAGGGGGAACGCCTAGC
ATATGAAAAATGGCTCAAGCCCGCGCAACCAGGATGGGAAGACCTGGTTGTGGACGCACGCGTTGCGGAA
TTGCACCAGTCTGCTCCGACGTGGTGCGAACACCAACCAGGCAACGACGTTTCTTCCAACGAGTCCGGGC
GCATCTCGGGCGTCCCAATTAACGCCGAGCAGGTGTCGCGTGCGTTCTTCGTGTACGATGGAGTGGCGCT
CGGAGCAGCCGAGCGCGCTGCGCATGATCGTTGGAGCAGGCCGGACCGGCCCACCTGGGAAGATCTTATC
ATAGTCGCGCGCCAAGCTGCTATCGAAGGCGGTGCCGTTTCGAATGGGATGATCGGGAAGACATCTTCCT
CAGTCTTTTTATACGAGGGAATGTTGCTTGGGGATGCGGAGCGTCAGGCGTACGGACGGTGGAGGCAGCT
AGCCCAGCCGCGGTGGCAAAATCTGGTGGTGAACGCGCGCCTGGCAGAGCTCGACCCGGCGGCCTGGATT
CCCGATGAACATGATCCGTCTGAGGATGGCGGGGCGACTGGTCTTCTGTCGCAAGCAAGCACGACCAATA
AGTCCCGCCTCAGTTTAGGTGATCAACCGGAAGCGCGCTCGCCTAGTCTCGCACGTGAGCCAGCACAACA
GCCGACTCACGTGCAAAACCTGACGTGCGCACAATTGGAAGCAAGACGTGCTCTATATTTCGGGCCCTCT
GGGAGGGATGCAGACCAAACCGCCAGCATCGCCGACAGTAATCGCCTCGACGAGGTAAGCAAAGTTAAAC
GGCTGGGTGCCAAGAGCCGTCGAGGCGCTAAAGCAACGGCCTATGACGTAATTTCAAGTGCGGAAAGACT
GTCGTCTCACGAGGGTTGTTTGACGGTTCAGTCCACTCAGCCAGAAAAAGCCGCTTGCTCGAGAAGCGAC
AATATCGGCACTTATGGAAGTCGAAAAAACGAACGAGCTCGGCTTGCGACCGAGACCGGGAAATACGAGT
CGGAGCATATTTTCGGGTTCAAGGTTGTCCACGATACCCTGCGCTCGACCAAAGAGGGCCGGCGGCTGGA
AAGGCCTATGCCCGCCTATCTCGAATGCAAGGAACTTCATCGACAACATGTTGGTACGGGAAGGGGGCGG
ACCCGACTGGTGGGGCGCGGCTGGCCAGATGACGCAAGTTACCGCTCGGATCAAAGGGCAACTCTATCGG
ACCCTGTTGCGTCCACGGAAGGTGCAACGGCGTCAAACGGGTATCAATTAAACCAGCTAGGCTACGCACA
CCAGCTCGCTAACGACGGGCTGCAGAGCGAAACGCCAGATGGGGTTATCATGCCGCTTCAGGTCGCGACT
ACTAGCTACAACTATACGGTAAGCCGCGATCCGGTACTTTCTCCGCCCAGTAAAGAGCAAGCTCCGGAAT
TGTTGCACCTTGGGCCACGTGGCCAGACAGAAGCTGTACTCGCTCGCGAAACAGCATTGACAGGAAGATG
GCCAACACGCGAGCGTGAGCAGCAAGTCTATCGAGAGTTTTTAGCCCTTTATGACGTCAAGAAGGACCTG
GAGGCCAAGACACTTGGGTTGCGGAAGAAAAAAGCTGCGCTTGTTTCCGCGTTGAACCGGACTGCCGCCT
CAATAGGCACTTCACCCTTGAAAGCCCAATCGTCGAGCGCAGAAGTTGAAAAAGCAACTCACGAGTTTGA
TGAACGACGGGTTTATGATCCGCGCGATCGCGGTCGGGACAAAGCATTACAACGGTGA
 Primer design

Reference
(1) Hodges LD; Lee LY; McNett H; Gelvin SB; Ream W (2009). The Agrobacterium rhizogenes GALLS gene encodes two secreted proteins required for genetic transformation of plants. J Bacteriol. 191(1):355-64. [PudMed:18952790] experimental
 
experimental experimental literature