SecReT4
Effector Protein ID: 190404487
T4SS name [ID]VirB [16]
Gene symbol-
Locus tagpRi2659_p144
StrainAgrobacterium rhizogenes plasmid pRi2659 (NC_010841)
Repliconplasmid pRi2659 [GenBank: NC_010841] [Browse all T4SS(s) in this replicon]
Location [Strand]181443..182798 [+]
Productrcorf143
Effector typeProtein
DescriptonVirE3
T4CP requirementT4CP Depedent
Target/EffectionVirE3 may be a plant transcription factor
UniProt IDA8W0J8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirE3 [PF06661], Evalue: 1.2e-167, Aligned region: 42..358
Protein Sequence: 451 a.a.     [Download]
>gi|190404487|ref|YP_001961118.1| rcorf143 [Agrobacterium rhizogenes]
MVSINKKAPQKSSTATTRNSDERLVDQLGQAYLVEREAQERRARLEAPPALKKYASKLQLLNKLDADFRG
VIAHKPFRSEQLRVDSNGELTHSRGLIKKKKKVFIRDQTTGSLRLIHYERSDWNSVRRYDYDQNGVLSEK
HIKSKAGAFEEKWERDENGELMRTRYIDRRRLTGRALHPISEEIGRPYESGLEKRLYRVLTRREGSQQKT
FERDDKGNLELIASKRMGYSMSSQKAPDRQTSRTSIRKLGGAFSESYRSRLDKDGHELGRDVSAHRSLLN
KRSAVYDDATGELKSSKHTFGKIYKAEATYLNAEIKEVSKKILGVTVGKELKTLSGRELEAQVLRAAERA
LHKQAWQHPSANPSRSQRENTNSHLGNELDGPLESDMTVVHQAGSGFVGDDRHVHDGGGSRLNELHESRS
SNDREKLSSPRAEICDRSMNRDRTGSGTLSR
-
Nucleotide Sequence: 1356 bp     [Download]
>gi|190404344|ref|NC_010841.1|:181443-182798 Agrobacterium rhizogenes plasmid pRi2659, complete sequence
ATGGTCAGTATAAATAAAAAAGCCCCGCAGAAATCTTCTACAGCGACCACGCGCAATTCTGATGAACGCC
TGGTTGATCAGTTAGGGCAGGCGTACCTTGTGGAACGCGAGGCGCAGGAAAGGCGCGCGCGACTTGAAGC
GCCGCCGGCGTTGAAAAAATATGCCTCGAAACTGCAACTCCTCAATAAGCTCGATGCAGATTTCCGTGGT
GTGATCGCCCACAAGCCGTTTCGCAGCGAGCAACTGCGGGTCGATAGCAATGGAGAATTGACCCATAGTC
GGGGTCTCATAAAAAAGAAGAAGAAGGTTTTCATTCGAGATCAAACAACTGGCTCCCTTCGGCTTATTCA
CTACGAGAGGTCTGACTGGAATAGTGTCCGTCGCTATGACTACGACCAGAACGGCGTGTTGAGCGAGAAA
CATATCAAAAGCAAAGCCGGTGCCTTCGAAGAAAAATGGGAGCGGGACGAAAACGGTGAACTGATGCGCA
CCCGATACATCGATCGGCGCAGACTTACTGGACGGGCGTTGCATCCCATTTCCGAGGAAATCGGACGTCC
TTATGAGAGTGGCCTGGAGAAGAGGCTTTATCGCGTTTTAACGCGTCGGGAGGGCTCCCAACAAAAGACT
TTCGAACGCGATGACAAGGGTAATCTGGAGCTCATTGCAAGCAAACGGATGGGCTATTCGATGTCTTCAC
AAAAGGCACCGGATCGACAAACATCTAGAACAAGTATCCGCAAGCTTGGCGGAGCTTTCAGTGAATCATA
TAGATCCCGGCTGGATAAGGACGGCCACGAGTTAGGTCGGGATGTCTCCGCACATCGAAGCCTCCTCAAC
AAGCGTTCAGCCGTCTACGATGACGCTACAGGGGAGCTAAAGAGCAGCAAGCACACGTTTGGGAAGATAT
ACAAAGCGGAAGCGACATACCTGAACGCCGAAATCAAAGAGGTCTCCAAAAAAATCCTCGGAGTTACGGT
CGGTAAAGAATTGAAGACATTAAGTGGACGCGAACTCGAGGCTCAAGTATTACGTGCCGCGGAACGTGCC
CTCCATAAACAGGCCTGGCAGCACCCTTCAGCTAACCCCTCGCGGTCGCAGCGGGAAAATACCAACAGTC
ATCTTGGAAACGAACTTGATGGGCCGCTCGAATCGGATATGACCGTCGTCCATCAAGCCGGATCCGGGTT
CGTCGGCGACGATCGCCACGTTCATGATGGCGGTGGATCCAGGTTGAATGAATTGCACGAATCGCGATCG
TCGAATGATAGGGAAAAGCTTAGTTCGCCGAGAGCCGAAATTTGCGACCGCTCGATGAATCGGGATCGCA
CCGGCTCAGGTACTTTGTCGCGATGA
 Primer design

Reference
(1) Hodges LD; Lee LY; McNett H; Gelvin SB; Ream W (2009). The Agrobacterium rhizogenes GALLS gene encodes two secreted proteins required for genetic transformation of plants. J Bacteriol. 191(1):355-64. [PudMed:18952790] experimental
 
experimental experimental literature