SecReT4
Effector Protein ID: 225685985
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_B0127
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012442] [Browse all T4SS(s) in this replicon]
Location [Strand]122166..122627 [-]
Producthypothetical protein
Effector typeProtein
DescriptonBPE123
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to BPE123. Function unknown
UniProt IDC0RK70
KEGG IDbmi:BMEA_B0127
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 153 a.a.     [Download]
>gi|225685985|ref|YP_002733957.1| hypothetical protein BMEA_B0127 [Brucella melitensis ATCC 23457]
MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAAASNGLERAVKAIRNERTDLTDASAKL
DARLAETQRVRREMDEAIEELNRLRKALSRDMRQARILAETPPPRQEKTPSATEQPLPADKNALPVFVRR
AVKKATVELAGQA
-
Nucleotide Sequence: 462 bp     [Download]
>gi|225685871|ref|NC_012442.1|:c122627-122166 Brucella melitensis ATCC 23457 chromosome II, complete sequence
ATGAGCTTGTTGCTGGCTAACGTGCTTTCCACATTGATGGCTCTTGCCTCGCTTGCGGCTTTGATCGTGG
TGGGCCGCAAGGCCAATGAAACCATCAGGCTCGGCAAGGTGCTGGCGCTGCGCGTCGCCGCCGCGTCAAA
CGGTCTGGAGCGCGCCGTAAAGGCGATCCGCAACGAACGTACCGACCTTACCGACGCCAGCGCCAAGCTT
GACGCCCGCCTTGCCGAAACGCAGCGCGTGCGCCGTGAAATGGACGAGGCGATCGAGGAATTGAACCGGC
TGCGCAAGGCGCTCTCGCGCGATATGCGCCAGGCGCGCATCTTGGCCGAAACGCCGCCACCCCGGCAGGA
GAAAACCCCGTCCGCCACAGAACAACCGCTCCCCGCAGACAAGAACGCGCTGCCCGTTTTCGTGCGCCGC
GCGGTCAAGAAGGCAACCGTTGAACTGGCGGGACAGGCATGA
 Primer design