SecReT4
Effector Protein ID: 225852528
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_A1064
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012441] [Browse all T4SS(s) in this replicon]
Location [Strand]1007470..1012143 [-]
Producthypothetical protein
Effector typeProtein
DescriptonBPE043
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to BPE043. Function unknown
UniProt IDC0RIZ9
KEGG IDbmi:BMEA_A1064
PDB IDNA
Domain hit(s) vs Pfam Apolipoprotein [PF01442], Evalue: 2.6e-38, Aligned region: 535..728
Apolipoprotein [PF01442], Evalue: 2.6e-38, Aligned region: 855..984
Apolipoprotein [PF01442], Evalue: 2.6e-38, Aligned region: 991..1161
Apolipoprotein [PF01442], Evalue: 2.6e-38, Aligned region: 1212..1521
Protein Sequence: 1557 a.a.     [Download]
>gi|225852528|ref|YP_002732761.1| hypothetical protein BMEA_A1064 [Brucella melitensis ATCC 23457]
MASKSKAQKLDLEVEKALEQALDIDFGDDIYIDMDLGAFDEGFSIDDLEEQISRAAEELVAEQQAKAAEP
VGNEPVVKAASVITTASVIATPAAPPVPPVVKAASSAPAIAANTEHKPANVVAEPVSAQETAAKPAAAVA
TATPVATPVRTPANDDSRSDKAIAAAPRRITEHSSKLYWTTTAISVAWAAGGVAISKAINPEVFSSLQAT
KDFFTAPAGLGVVAGVALPIAMFWGFAQLVKRAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRR
EVAAMNEGIERTLARAVELETLVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAH
EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFA
NLLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFE
ARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGN
VLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAARTGDIQNAIDASASALNEVTDKHAAI
LTERTSALQQAMSSNVSLLDASFADHARSLEERTASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVL
ARTFDERIGSLQSLIAENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHN
DALAHVLDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFEGQTG
IIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDGFGESFSARLID
NLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTSETLASHSESFSASVADNLAGTETR
LVERADAIATRLGDIGSRITMELGSVEARIAQVTDTTAVTLEERTRELNAVLAARSQEITKILNDTAEPL
VQRLADSGRGLAQQLEEATHAATDRLRSENAALVNALASRTAETIAAVQQAKVGLSDNVSELIDRLATSN
GELGKLIDAATRNLADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADR
FDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVASAFQRAEGQTR
VSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSE
QINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQK
PAPAASAEKPRGWVSDLLARASREEEEAAQPKVQPAATPRSPSHVVESLNSLSVDIARAIDHEASVELWD
RYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARNDRDNMVTQTYLTS
DTGKVYTMLAHASGRLR
-
Nucleotide Sequence: 4674 bp     [Download]
>gi|225851546|ref|NC_012441.1|:c1012143-1007470 Brucella melitensis ATCC 23457 chromosome I, complete sequence
ATGGCTTCAAAATCCAAGGCACAGAAGCTCGACCTTGAGGTTGAAAAGGCGCTGGAACAGGCACTGGATA
TCGATTTCGGAGACGATATTTATATCGATATGGACTTGGGTGCGTTTGACGAAGGCTTCTCGATTGACGA
TCTGGAAGAGCAGATTTCCCGTGCCGCGGAAGAACTCGTCGCCGAACAGCAGGCGAAAGCCGCCGAGCCT
GTTGGAAACGAGCCGGTCGTCAAGGCCGCTTCGGTCATCACAACGGCTTCCGTGATTGCAACGCCTGCTG
CGCCTCCGGTGCCGCCTGTCGTCAAGGCGGCCTCCTCTGCTCCCGCTATAGCCGCCAATACCGAGCACAA
ACCTGCCAATGTAGTTGCCGAACCCGTTTCAGCACAGGAGACCGCGGCCAAGCCTGCCGCTGCGGTCGCC
ACTGCAACGCCGGTCGCCACGCCTGTTCGTACACCAGCAAATGACGATTCGCGCAGCGACAAGGCCATCG
CCGCCGCGCCGCGCCGCATCACCGAGCATTCCTCTAAGCTTTACTGGACCACGACCGCAATCAGCGTGGC
GTGGGCGGCTGGCGGCGTTGCTATCAGCAAGGCGATCAATCCGGAAGTCTTCTCCAGCCTGCAAGCCACC
AAAGATTTCTTCACCGCACCCGCCGGACTTGGTGTGGTTGCCGGTGTGGCGCTGCCGATCGCGATGTTCT
GGGGCTTCGCACAACTCGTCAAGCGTGCTCAGGAAATGCAGAACGCTGCGCGCAGCATGACCGATGCCGC
GCTCAAACTGCTTCAGCCGGAAGCTGTCGCGGGTGATCGCGTCTCCACGCTGGGCCAGGCCGTGCGCCGC
GAAGTTGCAGCCATGAACGAAGGCATCGAACGCACACTTGCGCGCGCGGTGGAGCTGGAAACGCTCGTCC
AATCCGAGGTCAACCAGCTTGAGCGCGCCTATAGCGACAATGAGGTGCGTATCCGCTCGCTCGTTAGCGA
TCTTGGCAATGAGCGTGAAGCAGTTGTCAGCCATGCCGAGCGTGTTCGTTCGTCCATCTCTGGTGCGCAT
GAACAGCTTAGGGAAGAATTATCAAGTGCATCCAATATCATACGCGACAATGTTCTGTCCGCGTCTCAGC
AGCTCAGCGCGCTCTTGGGCGATTCTGGCGAGCGCCTCATCAGCAATATCAACGAAAGCGGCGGCGCTAT
TGCCGATGCAATCGAGAAGCGCACCGGCGATATTGGAAATCGCATCACCACCTCCGGCGAAGCTTTTGCC
AATCTGCTCGATACCCGCATCGCAACGCTTGACGAACAGTCGCGCACGATCTCCGGGAAGTTGACGCAGG
CTCTGGACGAGCGCACCACCGGCATTGCAAATGTGCTTGGCAGCGCGACCCAGACCATGGTGAGCGAGTT
CGACACGCGCCTTGCCAATCTGGAAAACACCCTTTCCGACCGTGGCCGCTCGTTGCTGGCAGAGTTTGAG
GCGCGCGCCCATGCGCTTGACAACAGCACCGAAAAGCTGAATGCGGCGCTGGAAACCCGTTCGCGCCAGA
TCAACGAAAACCTCATTGCCCGCACCCGTGAAATCGCCGAAACCTTCTCGGGCGGCCGCAATTCGCTGGG
CGCGATGGTGGACGACATCAAGGTGAAGATCGGCGACGATCTGACCTCGATCAGCGAAAGCGTCGGCAAT
GTTCTGATCGATAAGGCAGCAGCCTTCGAGGGCAAGCTGGCCGAAAGCCGCGATCTTCTGGCGGCAACGC
TGGAAGGCGAAACAGAGCGCGTTTCCTCGGTCATTCGCGGCCATGCGGATACGCTTGCCGCGCGCACCGG
CGATATCCAGAACGCTATCGATGCAAGCGCCTCAGCGCTCAATGAAGTCACAGACAAGCACGCGGCAATC
TTGACCGAGCGCACCAGTGCGCTGCAGCAGGCCATGTCCAGCAATGTTTCCCTGCTGGATGCGAGCTTCG
CAGACCATGCCCGTTCACTTGAAGAGCGCACTGCGTCCCTGCACAATGTCATTGCAGGAAATCAGGCAAT
GCTGGCTCAGCTCATGGATGAGCGTGCGGCTGCAATGCGCGAGAATTTCAACGAAAATCGTGAAGTGCTG
GCCCGCACCTTCGATGAACGTATTGGCAGCCTTCAGTCGCTTATCGCGGAAAACCAGAGCGCCCTTGAGC
GTATTCTGGATGAGCGCGCGCGCAATATGGCGGAATCCCTCGGCGCTGGCCGCGATGCCTTTGAAACGGC
ACTGGGCGAGCATGTCCGCACGGTCGAGGAACGCACAAGCGGCTTGCAAGCCGTTCTGAACAACCACAAT
GATGCGCTGGCGCATGTTCTGGATGGACATGAGCAGACCATTGAAACGCGGGCCGCTGAAATCCGCTCCA
CCCTGACGGACAGCACGGCTTCGCTCAGCCAGACCTTGCAGGATCATGGCGAGATTCTGGAGCAGCGCAC
CACGAGCCTGCAAAACGCCATCGCCAACAGCAGCGCCGCCATCAGCAGCGCCTTTGAGGGCCAGACCGGC
ATTATCGAAGAACGTACCGAGACCATGGAAAAGGCTCTTTCCATCGGCGTGGACAATGTGCGCCGCGCAC
TGGAACAAAGTGCAGGCGTGGTCGCCGGAAAGCTGCGTGAAAAGATCGGTGAAGCTGCCAGCACACTTGC
CGCTGAGGCCGCCAAAGCCGGCGAAGCCCTCGACGGCTTTGGCGAAAGCTTCAGTGCTCGGCTCATCGAT
AATCTTTCCGGCACCGAAGCCCGCCTCGGCGAACGCGCGGATGCTATTGCCGGACGCCTTGGCGACATTG
AAAGCCGCCTTACCGACGAGCTTGGGACCATTGAGGCACGCATTGCCGATACGGCCGCCAAAACAAGCGA
AACGCTTGCCAGCCACAGCGAATCCTTCTCGGCCAGCGTTGCCGACAATCTCGCTGGCACAGAAACACGT
CTTGTCGAGCGTGCGGATGCGATCGCAACCCGTCTTGGCGATATCGGCTCGCGCATCACGATGGAGCTCG
GCTCCGTCGAGGCTCGCATTGCGCAGGTGACGGATACGACGGCGGTTACGCTGGAAGAACGCACCCGTGA
GCTCAATGCCGTCCTCGCCGCTCGCTCGCAGGAAATCACCAAAATCCTCAACGATACGGCCGAACCGCTG
GTTCAGCGCCTTGCCGATAGTGGCCGTGGCCTTGCCCAGCAGCTTGAAGAAGCAACCCATGCAGCAACTG
ATCGCCTGCGTTCGGAAAATGCGGCGCTCGTCAATGCGCTGGCAAGCCGCACGGCGGAAACCATCGCTGC
GGTCCAGCAGGCAAAGGTCGGGCTTTCCGACAATGTCAGCGAACTCATTGACCGCCTCGCCACTTCCAAT
GGTGAGCTTGGCAAGCTGATTGATGCCGCCACGCGCAACCTTGCCGATATCGATGGGCGTCTGGTGGACT
CTACGACGAGCTTTGTGGAAAACACGAACCGCGCGGCGCAGATGTTCCAGGCTTCAACTGGCCTCATCGA
CAGCAATCTCGGTACGCTTCGTACGCTATCCGACAATACCTTGTCGCAAATCGCCGATATTGCCGACCGC
TTCGATGAACATGGCAAGGTTCTGTCTTCGGCATCCGATATGATCAATTCCGCACAGAACGGCCTCGTCA
GCACACTTGAGGAGCGTCATCAGGCGCTCGACAAGCTGGCTTCCGGTCTGGTGGAAAAATCGGAAGGCGT
CGAAAAGCTCATGCAATCCTTCGAGGCTCTGGTTGCCTCGGCCTTCCAGCGCGCCGAAGGCCAGACCCGC
GTTTCGGCGGAAAAGATGCGCGAGAGCGTTTCGGATATCGTCGAACAGGCCGCACAGAAGTTCTCGGCAG
CGACCGACGAAATTCGCCGCACGGCAAGCGAAATCCGCGCCGAACTCGATACAACGCGCGGCGAACTGAA
GCGCGGCGTTCTCGACATGCCTGCCGAAGCGAAGGAAACGACGACCGCCATGCGCAAGGCCGTGAGCGAG
CAGATCAACGCGCTCAAGGAACTTGCTGAAATTGTCAACAAGTCGGGCCGTCTGGTTGATGTGGGTGAAG
GCCGTGCCGACCGCCCTGTGTCGCGCCCCGCAGCATCTCGCCCTGCTCCGGTTCAAGCTCCTGTTCGGGC
ACCGATCGCGCCTCTGGCACAGACAGATGTTGCAGTCCGGTCGCGTCCGGTGGAAGCGCCGAACCAAAAG
CCTGCTCCAGCGGCATCTGCGGAAAAGCCGCGCGGTTGGGTTTCCGATCTTCTTGCCCGCGCCTCACGTG
AGGAAGAAGAAGCCGCGCAGCCCAAGGTGCAGCCGGCCGCAACGCCGCGTTCTCCGAGCCATGTGGTTGA
ATCGCTCAACTCGCTTTCCGTCGATATCGCCCGTGCTATCGACCACGAAGCTTCGGTTGAGCTTTGGGAC
CGTTATCGCCGCGGTGAGCGCAATGTTTTCACCCGCCGTCTCTATACGCTGAAAGGTCAGCAGACCTTTG
ACGATATCAAGCGCAAGTATCAGACCGATGGTGAATTCCGCCGCGCCGTAGATCGTTACATGAACGATTT
CCAGCGTCTTCTCGAAGACGTTGCCCGCAATGACCGCGATAATATGGTGACGCAGACTTACCTGACATCC
GACACAGGCAAGGTTTACACCATGCTCGCCCATGCAAGCGGACGCCTTCGGTAG
 Primer design