SecReT4
Effector Protein ID: 225852541
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_A1078
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012441] [Browse all T4SS(s) in this replicon]
Location [Strand]1021257..1022513 [-]
Producthypothetical protein
Effector typeProtein
DescriptonVceC
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to VceC. Function unknown
UniProt IDC0RJ12
KEGG IDbmi:BMEA_A1078
PDB IDNA
Domain hit(s) vs Pfam FliO [PF04347], Evalue: 1.3e-07, Aligned region: 37..94
Protein Sequence: 418 a.a.     [Download]
>gi|225852541|ref|YP_002732774.1| hypothetical protein BMEA_A1078 [Brucella melitensis ATCC 23457]
MKEWLSGIIGESAANIVGFVLIFAIILGGIFVVLGIIRRFSGGTFVSSGRMRQPRLSVMDAAAVDSRRKL
VLIRRDDVEHLLLIGGPTDVVVEQNIVLESRAGTHAPGTHALGTHAQSSRIEPEHIERFRQHEVLANENT
ERPALSVQSQPGDEREETIQLSSAIAAPVYRKPEPPKAENVRPAPSEPAPMRAPQPPVTPPPAAPRPEAP
ASQVSEPHPRPASNYPSQPRTVLPPRPAPSAAPNSVRAHPAYPLSQVSRGVVSSTSNIQAATVASAATAN
LGSIVPERESAAPAKPAAPAPNQPERSERPERPERPQQRIEPVVPFVAQEVRQPESADDDLDDLGGTLHD
AIMADLGSNAGKDENMEELDTASLEDELLSSLDISPTDEQPEDAKAEETIEDEMEKLLGELTKGETRN
-
Nucleotide Sequence: 1257 bp     [Download]
>gi|225851546|ref|NC_012441.1|:c1022513-1021257 Brucella melitensis ATCC 23457 chromosome I, complete sequence
ATGAAGGAATGGCTCAGCGGCATCATCGGTGAAAGCGCGGCTAATATTGTCGGCTTTGTGCTTATATTTG
CAATCATCCTTGGCGGAATTTTTGTTGTTCTCGGCATCATTCGCCGTTTCAGCGGCGGCACATTTGTATC
CAGCGGGCGCATGCGCCAGCCCCGCCTTTCGGTGATGGATGCCGCCGCGGTAGACAGCCGGCGCAAGCTG
GTTCTGATCCGCCGCGACGATGTGGAACATCTGCTCCTGATCGGTGGCCCGACCGATGTGGTTGTCGAAC
AGAATATCGTTCTGGAATCGCGCGCTGGCACCCATGCCCCTGGAACTCATGCCCTTGGTACCCACGCACA
GAGCTCGCGTATCGAACCGGAACATATTGAACGCTTCCGCCAGCACGAAGTGCTTGCCAATGAGAACACG
GAACGGCCTGCCCTTTCCGTCCAGTCCCAGCCCGGAGACGAACGCGAGGAAACTATTCAGCTAAGCTCGG
CCATCGCGGCGCCCGTCTATCGCAAGCCGGAGCCGCCGAAGGCTGAGAACGTCCGGCCCGCGCCCTCCGA
ACCCGCACCAATGCGGGCACCGCAGCCTCCCGTGACGCCACCGCCAGCCGCGCCGCGCCCTGAAGCGCCT
GCGTCGCAGGTTTCCGAGCCGCATCCGCGCCCAGCTTCAAATTACCCGTCACAGCCGCGCACGGTTCTTC
CCCCGCGCCCCGCGCCATCGGCTGCCCCAAACAGCGTTCGCGCGCATCCAGCCTATCCGCTGAGCCAGGT
TTCGCGCGGCGTGGTAAGTTCCACATCAAATATCCAGGCAGCCACGGTTGCATCGGCCGCGACAGCAAAT
CTGGGCAGCATTGTGCCCGAACGCGAATCTGCCGCTCCGGCAAAACCCGCAGCGCCCGCGCCGAATCAGC
CGGAACGTTCAGAGCGTCCAGAACGCCCGGAACGCCCACAACAACGCATCGAGCCGGTTGTTCCCTTTGT
CGCCCAGGAAGTCAGGCAGCCCGAAAGCGCAGATGACGATCTGGATGACCTTGGCGGCACATTGCATGAT
GCCATTATGGCCGATCTTGGCAGCAATGCCGGTAAAGATGAAAATATGGAGGAGTTGGACACGGCTTCGC
TGGAAGACGAACTACTCAGCTCGCTTGATATTTCACCTACCGATGAACAGCCGGAAGATGCCAAGGCCGA
AGAAACCATCGAAGACGAAATGGAAAAGCTGCTTGGTGAGTTGACCAAGGGAGAAACCCGCAATTAG
 Primer design