SecReT4
Effector Protein ID: 225852751
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_A1302
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012441] [Browse all T4SS(s) in this replicon]
Location [Strand]1241916..1242677 [-]
Productrhomboid family protein
Effector typeProtein
DescriptonBPE275
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to BPE275. Function unknown
UniProt IDC0RJM2
KEGG IDbmi:BMEA_A1302
PDB IDNA
Domain hit(s) vs Pfam Rhomboid [PF01694], Evalue: 2.1e-25, Aligned region: 84..240
Protein Sequence: 253 a.a.     [Download]
>gi|225852751|ref|YP_002732984.1| rhomboid family protein [Brucella melitensis ATCC 23457]
MLPKDKREQHFMSIPQPEMRGTGGREPIFNIPGVVIALIGLCVAVYVYQNYILSERQDFEFMMNFALIPA
RFSMASGFVDPAVIFTFISYSFMHGSFAHIAVNMIWLAAFGSPLAGRIGAVRMILFWVFTSVVAGLTHYA
LHPESLSPLVGASGAISGMMGAAARYGFRRVGYGRRSEFAGPVLPIGLTLTLKPVLIFVGVWFLINIVTG
LYSTGGADFSSIAWEAHIGGFIAGFFGIPLMDRPRSYDAVLRR
-
Nucleotide Sequence: 762 bp     [Download]
>gi|225851546|ref|NC_012441.1|:c1242677-1241916 Brucella melitensis ATCC 23457 chromosome I, complete sequence
ATGCTTCCGAAAGACAAGAGAGAGCAGCACTTCATGAGCATTCCCCAGCCGGAAATGCGCGGCACAGGCG
GCCGCGAGCCGATCTTCAATATTCCGGGTGTCGTGATTGCTCTGATCGGGTTGTGTGTCGCGGTCTATGT
CTATCAGAATTATATTCTGAGCGAGCGGCAGGATTTTGAGTTCATGATGAACTTTGCGCTGATCCCGGCG
CGCTTTTCGATGGCGAGCGGCTTTGTTGATCCGGCGGTGATTTTTACGTTTATCAGCTATTCCTTCATGC
ATGGCAGTTTTGCGCATATTGCCGTCAATATGATCTGGCTTGCCGCATTCGGCTCGCCGCTGGCCGGGCG
AATCGGCGCGGTCCGGATGATCCTATTCTGGGTTTTCACGTCGGTCGTCGCGGGGCTTACGCATTACGCA
CTCCATCCCGAAAGCCTTTCGCCGCTGGTGGGTGCGTCGGGCGCGATTTCGGGCATGATGGGAGCTGCCG
CCCGCTATGGTTTTCGGCGTGTCGGCTATGGCCGGCGCTCGGAATTTGCCGGGCCGGTGCTTCCCATCGG
GCTGACGCTGACGCTCAAGCCCGTCCTCATTTTTGTCGGCGTCTGGTTTCTCATCAATATCGTCACCGGC
CTTTATTCCACTGGCGGCGCTGACTTTTCCAGCATTGCCTGGGAGGCGCATATAGGCGGCTTCATTGCCG
GGTTTTTCGGGATTCCACTGATGGACCGCCCGCGCAGCTATGATGCCGTTTTGAGGCGATAG
 Primer design