SecReT4
Effector Protein ID: 225852754
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_A1305
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012441] [Browse all T4SS(s) in this replicon]
Location [Strand]1244605..1245132 [-]
Producthypothetical protein
Effector typeProtein
DescriptonRicA
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to RicA. RicA was demonstrated to interact with human small GTPase Rab2 involved in trafficking
UniProt IDC0RJM5
KEGG IDbmi:BMEA_A1305
PDB IDNA
Domain hit(s) vs Pfam Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 17..47
Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 75..105
Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 90..124
Protein Sequence: 175 a.a.     [Download]
>gi|225852754|ref|YP_002732987.1| hypothetical protein BMEA_A1305 [Brucella melitensis ATCC 23457]
MPIYAYNGHKPQFADRESNWIAPDATLIGKVVVGENAGFWFGAVLRGDNEPITIGADTNVQEQTIMHTDI
GFPLTIGAGCTIGHRAILHGCTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKEGMEIPDNSLVVGSPA
RVLRQLDDAAVEKLRASAKHYVERGHSFMRGMEPA
-
Nucleotide Sequence: 528 bp     [Download]
>gi|225851546|ref|NC_012441.1|:c1245132-1244605 Brucella melitensis ATCC 23457 chromosome I, complete sequence
ATGCCGATCTATGCATATAACGGGCACAAGCCGCAGTTTGCGGACCGCGAGAGCAACTGGATTGCACCGG
ATGCGACGCTGATCGGCAAGGTGGTCGTGGGCGAGAATGCGGGTTTCTGGTTCGGCGCGGTGTTGCGCGG
CGATAATGAGCCAATCACTATCGGTGCCGATACCAATGTGCAGGAACAGACGATCATGCACACCGATATC
GGCTTTCCGCTGACCATCGGTGCGGGCTGCACTATCGGGCACCGTGCGATTCTCCATGGCTGCACGATTG
GCGAGAATACTCTTATCGGCATGGGCGCGATTGTGCTCAATGGCGCGAAGGTCGGCAAGAATTGCCTTAT
CGGGGCGGGAACATTGGTGAAAGAAGGGATGGAAATCCCTGATAATTCGCTTGTTGTCGGCTCTCCCGCG
CGTGTCCTGCGCCAGCTTGACGATGCTGCCGTTGAAAAGCTGCGGGCCTCTGCAAAGCATTATGTGGAGA
GGGGACATTCCTTCATGCGCGGCATGGAGCCTGCCTGA
 Primer design