SecReT4
Effector Protein ID: 225853101
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_A1685
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012441] [Browse all T4SS(s) in this replicon]
Location [Strand]1601579..1601896 [+]
Producthypothetical protein
Effector typeProtein
DescriptonVceA
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to VceA. Function unknown
UniProt IDC0REQ8
KEGG IDbmi:BMEA_A1685
PDB IDNA
Domain hit(s) vs Pfam PepSY_2 [PF13670], Evalue: 1.7e-21, Aligned region: 5..85
Protein Sequence: 105 a.a.     [Download]
>gi|225853101|ref|YP_002733334.1| hypothetical protein BMEA_A1685 [Brucella melitensis ATCC 23457]
MKIIITAAALVALSATGAMAQKTQCDAKPLDEKSIDALVQLSNEFTWKISEMEIDDGCYELHVTDENGNV
LKVKVDPETMKVVAGKVKRYGDGTPAKDKGHAPKN
-
Nucleotide Sequence: 318 bp     [Download]
>gi|225851546|ref|NC_012441.1|:1601579-1601896 Brucella melitensis ATCC 23457 chromosome I, complete sequence
ATGAAAATCATCATCACGGCAGCAGCCCTGGTTGCACTGTCCGCCACGGGCGCAATGGCCCAAAAAACCC
AATGCGATGCAAAGCCGCTGGATGAGAAGTCCATCGATGCCTTGGTACAGTTGTCGAACGAATTTACGTG
GAAAATTTCCGAAATGGAGATTGACGACGGCTGTTATGAGCTGCACGTTACCGATGAAAACGGCAATGTC
CTCAAGGTCAAGGTGGACCCTGAAACGATGAAGGTGGTTGCTGGCAAAGTAAAGCGGTACGGCGATGGCA
CTCCGGCCAAGGACAAGGGCCACGCGCCCAAGAACTAG
 Primer design