SecReT4
Effector Protein ID: 225853440
T4SS name [ID]VirB [368]
Gene symbol-
Locus tagBMEA_A2063
StrainBrucella melitensis ATCC 23457
Repliconchromosome II [GenBank: NC_012441] [Browse all T4SS(s) in this replicon]
Location [Strand]1945934..1946395 [-]
Productlysophospholipase nte-1
Effector typeProtein
DescriptonBPE005
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to BPE005. Function unknown
UniProt IDC0RFP7
KEGG IDbmi:BMEA_A2063
PDB IDNA
Domain hit(s) vs Pfam cNMP_binding [PF00027], Evalue: 9.8e-21, Aligned region: 35..122
Protein Sequence: 153 a.a.     [Download]
>gi|225853440|ref|YP_002733673.1| lysophospholipase nte-1 [Brucella melitensis ATCC 23457]
MALDDDIRILGTVGLFESFTPEQLRLLAFGAERLVLRAGRELFREGQSADCAYIIVTGTITLFHEGDEGR
VTIRPVGPGAILGEMALIAQTTRLTGAVADVETEVIRISRSIFRRILEEYPEVAAALHAHISRNLVELIG
QIEQVAPRLANRD
-
Nucleotide Sequence: 462 bp     [Download]
>gi|225851546|ref|NC_012441.1|:c1946395-1945934 Brucella melitensis ATCC 23457 chromosome I, complete sequence
ATGGCGCTAGACGACGATATTCGCATTCTCGGCACGGTGGGCCTGTTCGAGTCTTTCACGCCCGAACAGT
TGCGCCTGCTTGCCTTCGGTGCGGAGCGGCTTGTCCTGCGTGCGGGACGCGAGCTTTTCCGCGAGGGCCA
GAGTGCCGATTGCGCCTATATCATCGTTACCGGCACGATTACCCTGTTTCATGAAGGTGATGAAGGGCGG
GTCACGATCCGCCCTGTCGGCCCCGGCGCGATATTGGGGGAAATGGCGCTCATCGCCCAGACCACTCGTC
TCACCGGCGCGGTGGCGGATGTGGAAACCGAAGTCATCCGCATCAGCCGCTCCATCTTCCGGCGCATTCT
GGAAGAATACCCGGAAGTGGCCGCCGCGCTTCATGCGCATATCAGCCGCAATCTTGTCGAGCTTATCGGC
CAGATCGAGCAGGTCGCGCCGCGGCTTGCAAACCGCGACTGA
 Primer design