SecReT4
Effector Protein ID: 308182704
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02715
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]534448..538050 [+]
Productcytotoxin-associated protein A
Effector typeProtein
DescriptonCagA
T4CP requirementT4CP Depedent
Target/EffectionCagA can cause gastritis and peptic ulcer, Injected CagA can act as a ‘master key’ that evolved the ability to highjack multiple host cell signalling cascades, which include the induction of membrane dynamics, actin-cytoskeletal rearrangements and the disruption of cell-to-cell junctions as well as proliferative, pro-inflammatory and anti-apoptotic nuclear responses (Backert et al, 2010).
UniProt IDE1Q638
KEGG IDhpc:HPPC_02715
PDB IDNA
Domain hit(s) vs Pfam CagA [PF03507], Evalue: 6e-118, Aligned region: 864..916
CagA [PF03507], Evalue: 6e-118, Aligned region: 910..1072
Protein Sequence: 1200 a.a.     [Download]
>gi|308182704|ref|YP_003926831.1| cytotoxin-associated protein A [Helicobacter pylori PeCan4]
MTNETIDQQPQTGAAFNPQQFINNLQVAFLKLDNAVASFDPDQKPIVDKNDRDNRQAFDGISQLREEYSN
KAIKNPTKKNQYFSDFINKSNDLINKDNLIDVESSTKSFQKFGDQRYRIFTSWVSHQNDPSKINTRSIRN
FMENIIQPPIHDDKEKAEFLKSAKQSFAGIIIGNQIRTDQKFMGVFDESLKERQEAEKNGEPTGGDWLDI
FLSFIFNKKQSSDVKEAINQEPVPHVQPDIATSTTHIQGLPPESRDLLDERGNFSKFTLGDMEMLDVEGV
ADIDPNYKFNQLLIHNNALSSVLMGSHNGIEPEKVSLLYAGNGGFGAKHDWNATVGYKDQQGNNVATIIN
VHMKNGSGLVIAGGEKGINNPSFYLYKEDQLTGSQRALSQEEIQNKVDFMEFLAQNNAKLDNLSEKEKEK
FRTEIENFQKNPKAYLDALGNDRIAFVSKKDPKHSALITEFGKGDLSYTLKDYGKKADKALDREKNVTLQ
GSLKHDGVMFVDYSNFKYTNASKNPNKGVGVTNGVSHLDAGFSKVAVFNLPDLNNLAITSFVRRNLEDKL
TAKGLSLQEANKLIKDFLSSNKELVGKALNFNKAVAEAKNTGNYDEVKKAQKDLEKSLRKREHLEKEVEK
KLESKSGNKNKMEAKSQANSQKDEIFALINKEANRDARAIAYSQNLKGIKRELSDKLESINKDLKDFSKS
FDALKSGKNKDFSNAEETLKALKSSVKDLGINPEWISKVENLNAALNEFKNGKNKDFSKVTQAKSDLENS
VKDVIINQKVTDKVDDLNQAVSVAKATGDFSRVEQALADLKNFSKEQLVQQAQKNESFNVGKKSEIYQSV
KNGVNGTLVGNGLSQAEATTLSKNFSDIKKELNAKLFGNNNNNNNNGLKNEPIYAKVNKKKTGQVASPEE
PIYAKVNKKKTGQVASPEEPIYAQVAKKVNAKIDRLNQIASGLGGVGQAAGFPLKRHDKVDDLSKVGRSV
SPEPIYATIDDLGGPFPLKRHDKVDDLSKVGLSREQKLAQKIDNLNQAVSEAKAGFFGNLEQTIDKLKDS
TKNNTVNLWAESAKKVPASLSAKLDNYATNSHTRINSNIHNGAINEKATGMLTQKNPEWLKLVNDKIVAH
NVGSVPLSEYDKIGFNQKNMKDYSDSFKFSTKLNNAVKDVKSGFTQFLANAFSTGYYCLARENAEHGIKN
VNTKGGFQKS
-
Nucleotide Sequence: 3603 bp     [Download]
>gi|308182188|ref|NC_014555.1|:534448-538050 Helicobacter pylori PeCan4 chromosome, complete genome
ATGACTAACGAAACTATTGACCAACAACCACAAACCGGAGCGGCTTTTAACCCGCAGCAATTTATCAATA
ATCTTCAAGTAGCTTTTCTTAAGCTTGATAACGCTGTCGCTTCATTTGATCCTGATCAAAAACCAATCGT
TGATAAGAACGATAGGGATAACAGGCAAGCTTTTGATGGAATCTCGCAATTAAGGGAAGAATACTCCAAT
AAAGCGATCAAAAATCCTACCAAAAAGAATCAGTATTTTTCAGACTTTATCAATAAGAGCAATGATTTAA
TCAACAAAGACAATCTCATTGATGTAGAATCTTCCACAAAGAGCTTTCAGAAATTTGGGGATCAGCGTTA
CCGAATTTTCACAAGTTGGGTGTCCCATCAAAACGATCCGTCTAAAATCAACACCCGATCGATCCGAAAT
TTTATGGAAAATATCATACAACCCCCTATCCATGATGACAAAGAAAAAGCAGAGTTTTTGAAATCTGCCA
AGCAATCTTTTGCAGGAATCATCATAGGGAATCAAATCCGAACGGATCAAAAGTTCATGGGCGTGTTTGA
TGAATCTTTGAAAGAAAGGCAAGAAGCAGAAAAAAATGGAGAGCCTACTGGTGGGGATTGGTTGGATATT
TTTCTCTCATTTATATTTAACAAAAAACAATCTTCTGATGTCAAAGAAGCAATCAATCAAGAACCAGTTC
CCCATGTCCAACCAGATATAGCCACTAGCACCACCCACATACAAGGCTTACCGCCTGAATCTAGGGATTT
GCTTGATGAAAGGGGTAATTTTTCTAAATTCACTCTTGGCGATATGGAAATGTTAGATGTTGAGGGAGTT
GCCGACATTGATCCTAATTACAAGTTCAATCAATTATTGATTCACAATAACGCTCTGTCTTCTGTGTTAA
TGGGGAGTCATAATGGCATAGAACCTGAAAAAGTTTCATTATTGTATGCGGGCAATGGTGGTTTTGGAGC
CAAACACGATTGGAACGCCACCGTTGGTTATAAAGACCAACAAGGTAACAATGTGGCTACAATAATTAAT
GTGCATATGAAAAACGGCAGTGGATTAGTCATAGCAGGTGGTGAGAAAGGGATTAATAATCCTAGTTTTT
ATCTCTACAAAGAAGACCAACTCACAGGCTCACAACGAGCATTGAGCCAAGAAGAGATCCAAAACAAAGT
AGATTTCATGGAATTTCTTGCACAAAACAATGCTAAATTAGACAACTTGAGCGAGAAAGAGAAGGAAAAA
TTCCGAACTGAGATTGAAAATTTCCAAAAAAACCCTAAGGCTTATTTAGACGCCCTAGGGAATGATCGTA
TTGCTTTTGTTTCTAAAAAAGACCCAAAACATTCAGCTTTAATTACTGAGTTTGGTAAGGGGGATTTGAG
CTACACTCTCAAAGATTATGGGAAAAAAGCAGATAAAGCTTTAGATAGGGAGAAAAATGTCACTCTTCAA
GGTAGCCTAAAACATGATGGCGTGATGTTTGTTGATTATTCTAATTTCAAATACACCAACGCCTCCAAGA
ATCCCAATAAGGGTGTAGGCGTTACGAATGGCGTTTCCCATTTAGACGCAGGCTTTAGCAAGGTAGCTGT
CTTTAATTTGCCTGATTTAAATAATCTCGCTATCACTAGTTTCGTAAGGCGGAATTTAGAGGATAAACTA
ACCGCTAAAGGATTGTCCCTACAAGAAGCTAATAAGCTTATCAAAGATTTTTTGAGCAGCAACAAAGAAT
TGGTTGGAAAAGCTTTAAACTTCAATAAAGCTGTAGCTGAAGCTAAAAACACAGGCAACTATGATGAAGT
GAAAAAAGCTCAGAAAGATCTTGAAAAATCTCTAAGGAAACGAGAGCATTTAGAGAAAGAAGTAGAGAAA
AAATTGGAGAGCAAAAGCGGCAACAAAAATAAAATGGAAGCAAAATCTCAAGCTAACAGCCAGAAAGATG
AGATTTTTGCGTTGATCAATAAAGAGGCTAATAGGGACGCAAGAGCAATCGCTTACAGTCAAAATCTTAA
AGGTATCAAAAGGGAATTGTCTGATAAGCTTGAAAGCATCAACAAGGATTTGAAAGACTTTAGTAAATCT
TTTGATGCACTCAAAAGTGGCAAAAATAAGGATTTCAGCAATGCAGAAGAAACGCTAAAAGCCCTTAAAA
GCTCGGTGAAAGATTTGGGTATCAATCCAGAATGGATTTCAAAAGTTGAAAACCTTAATGCAGCTTTGAA
TGAATTCAAAAATGGCAAAAATAAGGATTTCAGCAAGGTAACGCAAGCAAAAAGCGACCTTGAAAATTCC
GTTAAAGATGTGATCATCAATCAAAAGGTAACGGATAAAGTTGATGATCTCAATCAAGCGGTATCAGTGG
CTAAAGCAACGGGTGATTTCAGTAGGGTAGAGCAAGCGTTAGCCGATCTCAAAAATTTCTCAAAGGAGCA
ATTGGTTCAACAAGCTCAAAAAAATGAAAGTTTCAATGTTGGAAAAAAATCTGAAATATACCAATCCGTT
AAGAATGGTGTGAACGGAACCCTAGTCGGTAATGGGTTATCTCAAGCAGAAGCCACAACTCTTTCTAAAA
ACTTTTCGGACATCAAGAAAGAGTTGAATGCAAAACTTTTTGGAAATAACAATAACAATAACAATAATGG
ACTCAAAAACGAACCCATTTATGCTAAAGTTAATAAAAAGAAAACAGGACAAGTAGCTAGCCCTGAAGAA
CCCATTTATGCTAAAGTTAATAAAAAGAAAACAGGACAAGTAGCTAGCCCTGAAGAACCCATTTACGCTC
AAGTTGCTAAAAAGGTAAATGCAAAAATTGACCGACTCAATCAAATAGCAAGTGGTTTGGGTGGTGTAGG
GCAAGCAGCGGGCTTCCCTTTGAAAAGGCATGATAAAGTTGATGATCTCAGTAAGGTAGGGCGATCAGTT
AGCCCTGAACCCATTTATGCTACGATTGATGATCTCGGCGGACCTTTCCCTTTGAAAAGGCATGATAAAG
TTGATGATCTCAGTAAGGTAGGGCTTTCAAGGGAGCAAAAATTGGCTCAGAAAATTGACAATCTCAATCA
GGCGGTGTCAGAAGCTAAAGCAGGTTTTTTTGGCAATCTAGAGCAAACGATAGACAAGCTCAAAGATTCT
ACAAAAAACAATACTGTGAATCTATGGGCTGAAAGTGCAAAAAAAGTGCCTGCTAGTTTGTCAGCGAAAT
TGGACAATTACGCTACTAACAGCCACACACGCATTAATAGCAATATCCACAATGGAGCAATCAATGAAAA
AGCGACCGGTATGCTAACGCAAAAAAACCCTGAGTGGCTCAAGCTCGTGAATGATAAAATAGTTGCACAT
AATGTAGGAAGCGTTCCTTTGTCAGAGTATGATAAAATTGGCTTCAACCAAAAGAATATGAAAGATTATT
CTGATTCGTTCAAGTTTTCCACCAAGTTGAACAATGCTGTAAAAGACGTTAAGTCTGGCTTTACGCAATT
TTTAGCCAATGCATTTTCTACAGGATATTACTGCTTGGCGAGGGAAAATGCGGAGCATGGAATCAAAAAT
GTTAATACAAAAGGTGGTTTCCAAAAATCTTAA
 Primer design