SecReT4
Effector Protein ID: 319898801
T4SS name [ID]VirB [230]
Gene symbol-
Locus tagBARCL_0632
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]693480..695072 [+]
ProductBartonella effector protein (Bep); substrate of VirB T4SS
Effector typeProtein
DescriptonBepA
T4CP requirementT4CP Depedent
Target/EffectionHomologous to BepA protein of Bartonella henselae. The Bartonella-translocated effector protein (BepA-BepG) are required for invasion, proinflammatory activation and antiapoptotic protection of endothelial cells.
UniProt IDE6YHH5
KEGG IDbcd:BARCL_0632
PDB IDNA
Domain hit(s) vs Pfam Fic [PF02661], Evalue: 4.1e-13, Aligned region: 49..162
Protein Sequence: 530 a.a.     [Download]
>gi|319898801|ref|YP_004158894.1| Bartonella effector protein (Bep); substrate of VirB T4SS [Bartonella clarridgeiae 73]
MYSFYYYPDTQILKNKYGIMNEKELNAQCSRDTAKAIVSLRQEPLPEKFDSSYLKYLHKCLFANTFEWAG
HTRNLPFKFEDGTRGKLLVMRIPNSNNFFVSGSNIKKSLQEFDKTLSEKNNLQGLSRKEFIEEAVKLFSF
LNYIHPFRTSNGRAQRMFFEKLAEAAGHRLDFSVVTKQRMIRVCNDAIPVKGNINYEGMKHLFEDISNPE
KVYLLKKFVCQVPKAERKNLNNKVVIISREGMTYEGLYIKSGLDSVMIETKDFCVICHKDYLTPEQLKTL
KPGNQLTVTVPINDLNKILIPAEKLAPLTEDDIIKKIENDAGVQASRKKIEELSKLVYGNSKILNSSITL
IHTNFDFGSDLSKQIINSPKSISKLLGYKILGIRSPARKNAESNISALSTEVNKYVDMVLEIKYEIIGKH
KAKEKRLAQTVKMPSKEMQDMLNLSRRMQIKTLESSPALYTELTHFMRKITLRLSTRENQGLRNANYKEL
SESIGISENKAKIIIETVDKTKRLLELLQPNRPQMITKTI
-
Nucleotide Sequence: 1593 bp     [Download]
>gi|319898193|ref|NC_014932.1|:693480-695072 Bartonella clarridgeiae 73, complete genome
ATGTATTCATTCTATTATTATCCTGATACTCAAATATTAAAAAATAAATATGGAATAATGAATGAAAAAG
AATTAAATGCCCAATGCAGTCGTGATACAGCAAAAGCAATTGTCAGTTTGCGTCAAGAACCACTACCAGA
AAAGTTTGATTCTTCTTATTTAAAATATCTCCATAAATGCTTATTTGCGAACACGTTTGAATGGGCCGGA
CATACCCGCAATCTCCCCTTTAAGTTTGAAGATGGCACGCGTGGCAAATTGTTGGTGATGCGAATACCAA
ACTCAAATAATTTTTTTGTCAGTGGTAGCAATATCAAAAAAAGCTTGCAGGAATTTGATAAGACGCTTTC
TGAAAAGAATAATTTACAAGGATTATCGCGTAAAGAATTTATCGAGGAGGCGGTAAAGCTTTTTTCCTTT
CTTAACTATATACATCCATTCAGAACTAGTAATGGACGTGCGCAACGAATGTTTTTTGAAAAGCTTGCAG
AAGCCGCAGGTCATAGGCTTGATTTTTCAGTTGTGACAAAACAACGCATGATACGTGTTTGTAATGATGC
GATACCTGTAAAAGGTAATATAAATTATGAAGGGATGAAACATCTCTTTGAAGATATTTCCAATCCAGAG
AAAGTATATCTTTTAAAAAAATTTGTTTGCCAGGTACCTAAGGCTGAACGTAAAAATCTAAATAATAAAG
TTGTTATAATTTCACGTGAAGGTATGACCTATGAGGGTCTCTATATAAAGAGTGGTTTAGATTCTGTTAT
GATTGAAACAAAGGATTTTTGCGTCATATGCCATAAAGATTATCTTACACCAGAACAACTGAAGACATTA
AAACCCGGTAATCAGCTTACTGTTACAGTTCCAATAAATGATTTAAACAAAATACTCATCCCAGCAGAAA
AATTAGCTCCCTTGACAGAAGACGACATAATCAAAAAAATTGAAAATGATGCTGGTGTTCAAGCAAGTCG
AAAAAAAATCGAAGAGCTATCAAAACTTGTTTACGGCAATTCAAAAATATTAAATTCAAGTATAACGCTT
ATTCATACAAATTTCGATTTCGGTAGTGATCTTTCTAAACAGATTATAAATTCTCCTAAATCTATTTCTA
AGTTATTAGGTTACAAAATATTAGGCATAAGAAGTCCAGCACGTAAAAACGCTGAAAGCAATATTAGTGC
ACTTAGTACTGAAGTTAATAAGTATGTAGATATGGTATTAGAGATTAAATATGAGATTATTGGAAAACAT
AAAGCAAAAGAAAAGCGCCTTGCACAAACAGTAAAGATGCCTAGTAAAGAAATGCAAGATATGCTTAACT
TATCTAGAAGAATGCAAATAAAGACTTTAGAGAGCTCTCCTGCACTTTACACAGAACTCACTCATTTTAT
GCGCAAAATCACTCTGCGTCTTTCAACAAGAGAGAATCAAGGGCTTCGTAATGCTAATTATAAAGAACTT
TCTGAAAGTATTGGTATATCAGAAAATAAAGCAAAGATAATAATAGAAACCGTTGATAAAACTAAAAGGT
TATTGGAGCTATTGCAACCTAACCGCCCACAAATGATAACTAAGACCATCTGA
 Primer design

Reference
(1) Engel P; Salzburger W; Liesch M; Chang CC; Maruyama S; Lanz C; Calteau A; Lajus A; Medigue C; Schuster SC; Dehio C (2011). Parallel evolution of a type IV secretion system in radiating lineages of the host-restricted bacterial pathogen Bartonella. PLoS Genet. 7(2):e1001296. [PudMed:21347280] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature