SecReT4
Effector Protein ID: 319898804
T4SS name [ID]VirB [231]
Gene symbol-
Locus tagBARCL_0635
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]698179..699882 [-]
ProductBartonella effector protein (Bep); substrate of VirB T4SS
Effector typeProtein
DescriptonBepA
T4CP requirementT4CP Depedent
Target/EffectionHomologous to BepA protein of Bartonella henselae. The Bartonella-translocated effector protein (BepA-BepG) are required for invasion, proinflammatory activation and antiapoptotic protection of endothelial cells.
UniProt IDE6YHH8
KEGG IDbcd:BARCL_0635
PDB IDNA
Domain hit(s) vs Pfam Fic [PF02661], Evalue: 1e-09, Aligned region: 79..191
Protein Sequence: 567 a.a.     [Download]
>gi|319898804|ref|YP_004158897.1| Bartonella effector protein (Bep); substrate of VirB T4SS [Bartonella clarridgeiae 73]
MKKTLNKHFPPPTLQELNTLYFNKTEKLEALPDNYTYSNSNTLKNKYGIKDFIRFVQKCEHDVAEAVVNL
RQEALPKKFDSSYLKYLHKRLFENTFEWAGHTRDLPFKFEDGTVAVMRKIGSSSSIVSLAVGDKIKECLE
KIDRTLSKKNNLQGLSREEFVNDAGEIFAFLTNVYPFREGNGLTQQIFFEKLAEAAGHKLDFSVATKERM
TRIYSDAIMLKGDVDNTTTVKHLFEDISNPEKVRILKEFINYRIRVDVDSCNINDQIIVAPNEGDTYTGT
YEADSPNSIMIKTMDSCVICHKDYLTPEQLKALKFGDKITFIAPITKNLDKILIPAEKLAPLTEKKIIET
IINNIYILKNREEIEHLSKLVYGNSKILDQNLHLIHKNPETSKQLAEQIENSPQSISKFAGFKIWIIKSP
KRKIAEKNFSKLSQAIEKYVDTIESTKNRILKEHQVEQRRVKQAIEMPSEAVLNILNSPKDKWNKYLESS
PLLREEFNNFMSKIVLRLSTSEHKALNDADYKTLAESIGISENRARIITEIFNKAKEICIEFRAFQINKL
KIMMIEN
-
Nucleotide Sequence: 1704 bp     [Download]
>gi|319898193|ref|NC_014932.1|:c699882-698179 Bartonella clarridgeiae 73, complete genome
ATGAAAAAAACTCTAAATAAGCATTTTCCCCCTCCTACATTGCAAGAGCTAAATACTTTATACTTCAATA
AAACAGAAAAACTTGAAGCATTACCTGATAATTATACCTATTCTAACAGCAATACACTAAAAAATAAATA
TGGAATAAAAGACTTTATACGCTTTGTTCAAAAATGTGAGCATGATGTAGCAGAAGCAGTTGTCAATTTA
CGTCAAGAAGCACTACCAAAAAAGTTTGATTCCTCCTATTTAAAATACCTTCATAAACGCTTATTTGAAA
ATACGTTTGAATGGGCTGGGCATACCCGCGATCTCCCATTTAAGTTTGAAGATGGTACAGTTGCCGTCAT
GAGAAAAATCGGTAGTTCATCCTCGATAGTTTCTCTAGCAGTTGGTGATAAAATTAAAGAATGTTTAGAA
AAAATCGATAGAACACTTTCTAAAAAAAACAATTTACAAGGATTATCGCGCGAAGAGTTTGTTAATGATG
CAGGGGAAATATTTGCTTTTCTTACTAATGTATATCCATTTAGAGAAGGGAATGGGCTTACACAACAAAT
ATTTTTTGAAAAGCTTGCAGAAGCTGCAGGTCATAAGCTTGATTTTTCAGTTGCGACAAAAGAACGCATG
ACACGTATCTATAGTGATGCAATAATGCTAAAAGGTGATGTAGATAATACAACTACTGTGAAGCATCTGT
TTGAAGATATTTCCAATCCAGAAAAAGTACGTATTTTAAAGGAATTCATCAACTACAGAATAAGAGTAGA
TGTTGACTCCTGTAATATAAATGATCAAATTATTGTAGCACCAAATGAAGGAGATACCTACACGGGCACC
TATGAAGCTGATAGCCCAAATTCCATTATGATTAAAACAATGGATTCTTGTGTTATATGCCATAAAGATT
ATCTCACACCAGAACAACTTAAGGCATTAAAATTTGGTGATAAAATCACCTTTATAGCTCCAATAACCAA
AAATTTAGACAAGATTCTCATTCCAGCGGAGAAATTAGCTCCTTTAACGGAAAAAAAAATAATCGAAACG
ATTATAAATAATATCTATATTTTAAAAAATCGAGAAGAAATCGAGCATTTATCAAAACTTGTCTATGGCA
ACTCAAAAATATTAGATCAAAATCTGCATCTTATTCATAAGAATCCTGAAACAAGTAAACAGCTTGCCGA
ACAGATTGAAAATTCTCCTCAATCCATTTCTAAGTTTGCGGGTTTTAAAATATGGATAATAAAGAGTCCA
AAACGCAAAATAGCTGAAAAGAATTTTTCAAAACTTAGTCAAGCAATTGAAAAATATGTAGATACTATAG
AATCTACTAAAAATAGAATTCTTAAAGAGCATCAAGTAGAACAAAGACGTGTTAAACAAGCAATAGAAAT
GCCTAGCGAAGCAGTATTAAATATTCTTAATTCACCAAAGGATAAATGGAACAAATATTTAGAGTCTTCC
CCTTTACTTCGAGAAGAATTCAATAACTTTATGAGTAAAATCGTTTTGCGTCTTTCAACAAGCGAGCATA
AAGCACTTAATGATGCTGATTATAAAACACTCGCTGAAAGCATTGGCATATCAGAAAATAGAGCGAGAAT
AATTACAGAAATTTTTAATAAAGCCAAAGAAATATGCATCGAATTTCGAGCTTTCCAAATAAATAAATTG
AAAATAATGATGATAGAAAATTAA
 Primer design

Reference
(1) Engel P; Salzburger W; Liesch M; Chang CC; Maruyama S; Lanz C; Calteau A; Lajus A; Medigue C; Schuster SC; Dehio C (2011). Parallel evolution of a type IV secretion system in radiating lineages of the host-restricted bacterial pathogen Bartonella. PLoS Genet. 7(2):e1001296. [PudMed:21347280] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature