SecReT4
Effector Protein ID: 33598789
T4SS name [ID]Ptl [387]
Gene symbolptxA
Locus tagBPP4304
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4637270..4638079 [+]
Producttoxin subunit 1
Effector typeProtein
DescriptonPtxA
T4CP requirementT4CP Indepedent
Target/EffectionA subunit of pertussis toxin (PT). PT is involved in the colonization of the respiratory tract and the establishment of infection of Bordetella pertussis causing whooping cough
UniProt IDQ7W2U8
KEGG IDbpa:BPP4304
PDB IDNA
Domain hit(s) vs Pfam Pertussis_S1 [PF02917], Evalue: 3.6e-127, Aligned region: 36..268
Protein Sequence: 269 a.a.     [Download]
>gi|33598789|ref|NP_886432.1| ptxA gene product [Bordetella parapertussis 12822]
MRCTRAIRQTARTGWLTWLAILAVTAPMTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLEHL
TGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEIRADNNFYGAASSYFE
YVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRTVTRVYHNGITGETTTTEYPNLRYVSQQTRANTN
PYTSRRSTASIVGTLVRMAPVTGACMARQAESPEAMAAWSERTGEAMVLVYYESIAYSF
-
Nucleotide Sequence: 810 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4637270-4638079 Bordetella parapertussis 12822 chromosome, complete genome
ATGCGTTGCACTCGGGCAATTCGCCAAACCGCAAGAACAGGCTGGCTGACGTGGCTGGCGATTCTTGCCG
TCACGGCGCCCATGACTTCGCCGGCATGGGCCGACGATCCGCCCGCCACGGTATACCGCTATGACTCCCG
CCCGCCGGAGGACGTTTTCCAGAACGGATTCACGGCGTGGGGAAACAACGACAATGTGCTTGAACACCTG
ACCGGACGTTCCTGCCAGGTCGGCAGCAGCAACAGCGCTTTCGTCTCCACCAGCAGCAGCCGGCGCTATA
CCGAGGTCTATCTCGAACATCGCATGCAGGAAGCGGTCGAGGCCGAACGCGCCGGCAGGGGCACCGGCCA
CTTCATCGGCTACATCTACGAAATCCGCGCCGACAACAATTTCTACGGCGCCGCCAGCTCGTACTTCGAA
TACGTCGACACTTATGGCGACAATGCCGGCCGTATCCTCGCCGGCGCGCTGGCCACCTACCAGAGCGAAT
ATCTGGCGCACCGGCGCATTCCGCCCGAGAACATCCGCACGGTAACGCGCGTCTATCACAACGGCATCAC
CGGCGAGACCACGACCACGGAATATCCGAACCTTCGCTACGTCAGCCAGCAGACTCGCGCCAATACCAAC
CCCTATACATCGCGAAGGTCCACCGCGTCGATCGTCGGCACATTGGTGCGCATGGCGCCGGTGACGGGCG
CTTGCATGGCGCGGCAGGCCGAAAGCCCCGAGGCCATGGCAGCCTGGTCCGAGCGCACCGGCGAGGCGAT
GGTTCTCGTGTACTACGAAAGCATCGCGTATTCGTTCTAG
 Primer design

Reference
(1) Parkhill J; Sebaihia M; Preston A; Murphy LD; Thomson N; Harris DE; Holden MT; Churcher CM; Bentley SD; Mungall KL; Cerdeno-Tarraga AM; Temple L; James K; Harris B; Quail MA; Achtman M; Atkin R; Baker S; Basham D; Bason N; Cherevach I; Chillingworth T; Collins M; Cronin A; Davis P; Doggett J; Feltwell T; Goble A; Hamlin N; Hauser H; Holroyd S; Jagels K; Leather S; Moule S; Norberczak H; O'Neil S; Ormond D; Price C; Rabbinowitsch E; Rutter S; Sanders M; Saunders D; Seeger K; Sharp S; Simmonds M; Skelton J; Squares R; Squares S; Stevens K; Unwin L; Whitehead S; Barrell BG; Maskell DJ (2003). Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica. Nat Genet. 35(1):32-40. [PudMed:12910271]