SecReT4
Effector Protein ID: 33598790
T4SS name [ID]Ptl [387]
Gene symbolptxD
Locus tagBPP4306
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4638793..4639251 [+]
Producttoxin subunit 4
Effector typeProtein
DescriptonPtxD
T4CP requirementT4CP Indepedent
Target/EffectionA subunit of pertussis toxin (PT). PT is involved in the colonization of the respiratory tract and the establishment of infection of Bordetella pertussis causing whooping cough
UniProt IDP0A3R6
KEGG IDbpa:BPP4306
PDB IDNA
Domain hit(s) vs Pfam Pertus-S4-tox [PF09275], Evalue: 7.3e-77, Aligned region: 43..152
Protein Sequence: 152 a.a.     [Download]
>gi|33598790|ref|NP_886433.1| ptxD gene product [Bordetella parapertussis 12822]
MLRRFPTRTTAPGQGGARRSRVRALAWLLASGAMTHLSPALADVPYVLVKTNMVVTSVAMKPYEVTPTRM
LVCGIAAKLGAAASSPDAHVPFCFGKDLKRPGSSPMEVMLRAVFMQQRPLRMFLGPKQLTFEGKPALELI
RMVECSGKQDCP
-
Nucleotide Sequence: 459 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4638793-4639251 Bordetella parapertussis 12822 chromosome, complete genome
ATGCTGAGACGCTTCCCCACTCGAACCACCGCCCCGGGACAGGGCGGCGCCCGGCGGTCGCGCGTGCGCG
CCCTGGCGTGGTTGCTGGCATCCGGCGCGATGACGCATCTTTCCCCCGCCCTGGCCGACGTTCCTTATGT
GCTGGTGAAGACCAATATGGTGGTCACCAGCGTAGCCATGAAGCCGTATGAAGTCACCCCGACGCGCATG
CTGGTCTGCGGCATCGCCGCCAAGCTGGGCGCCGCGGCCAGCAGCCCGGACGCGCACGTGCCGTTCTGCT
TCGGCAAGGATCTCAAGCGTCCCGGCAGCAGTCCCATGGAAGTCATGTTGCGCGCCGTCTTCATGCAACA
ACGGCCGCTGCGCATGTTCCTGGGTCCCAAGCAACTCACTTTCGAAGGCAAGCCCGCGCTCGAACTGATC
CGGATGGTCGAATGCAGCGGCAAGCAGGATTGCCCCTGA
 Primer design

Reference
(1) Parkhill J; Sebaihia M; Preston A; Murphy LD; Thomson N; Harris DE; Holden MT; Churcher CM; Bentley SD; Mungall KL; Cerdeno-Tarraga AM; Temple L; James K; Harris B; Quail MA; Achtman M; Atkin R; Baker S; Basham D; Bason N; Cherevach I; Chillingworth T; Collins M; Cronin A; Davis P; Doggett J; Feltwell T; Goble A; Hamlin N; Hauser H; Holroyd S; Jagels K; Leather S; Moule S; Norberczak H; O'Neil S; Ormond D; Price C; Rabbinowitsch E; Rutter S; Sanders M; Saunders D; Seeger K; Sharp S; Simmonds M; Skelton J; Squares R; Squares S; Stevens K; Unwin L; Whitehead S; Barrell BG; Maskell DJ (2003). Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica. Nat Genet. 35(1):32-40. [PudMed:12910271]