SecReT4
Effector Protein ID: 33598791
T4SS name [ID]Ptl [387]
Gene symbolptxE
Locus tagBPP4307
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4639263..4639625 [+]
Producttoxin subunit 5
Effector typeProtein
DescriptonPtxE
T4CP requirementT4CP Indepedent
Target/EffectionA subunit of pertussis toxin (PT). PT is involved in the colonization of the respiratory tract and the establishment of infection of Bordetella pertussis causing whooping cough
UniProt IDQ7W2U7
KEGG IDbpa:BPP4307
PDB IDNA
Domain hit(s) vs Pfam Pertus-S5-tox [PF09276], Evalue: 7.3e-66, Aligned region: 24..120
Protein Sequence: 120 a.a.     [Download]
>gi|33598791|ref|NP_886434.1| ptxE gene product [Bordetella parapertussis 12822]
MHTIASILLSVLGIYSPADVAGLPTHLYKNFTVQELALKLKGKNQEFCLTAFMPGRSLVRACLSDAGHEH
DTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
-
Nucleotide Sequence: 363 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4639263-4639625 Bordetella parapertussis 12822 chromosome, complete genome
ATGCATACCATCGCATCCATCCTGTTGTCCGTGCTCGGCATATACAGCCCGGCCGACGTCGCCGGCCTGC
CGACCCATCTGTACAAGAACTTCACTGTCCAGGAGCTGGCCTTGAAACTGAAGGGCAAGAATCAGGAGTT
CTGCCTGACCGCCTTCATGCCGGGCAGAAGCCTGGTCCGGGCGTGCCTGTCCGACGCGGGACACGAGCAC
GACACGTGGTTCGACACCATGCTTGGCTTTGCCATATCCGCGTATGCGCTCAAGAGCCGGATCGCGCTGA
CGGTGGAAGACTCGCCGTATCCGGGCACTCCCGGCGATCTGCTCGAACTGCAGATCTGCCCGCTCAACGG
ATATTGCGAATGA
 Primer design

Reference
(1) Parkhill J; Sebaihia M; Preston A; Murphy LD; Thomson N; Harris DE; Holden MT; Churcher CM; Bentley SD; Mungall KL; Cerdeno-Tarraga AM; Temple L; James K; Harris B; Quail MA; Achtman M; Atkin R; Baker S; Basham D; Bason N; Cherevach I; Chillingworth T; Collins M; Cronin A; Davis P; Doggett J; Feltwell T; Goble A; Hamlin N; Hauser H; Holroyd S; Jagels K; Leather S; Moule S; Norberczak H; O'Neil S; Ormond D; Price C; Rabbinowitsch E; Rutter S; Sanders M; Saunders D; Seeger K; Sharp S; Simmonds M; Skelton J; Squares R; Squares S; Stevens K; Unwin L; Whitehead S; Barrell BG; Maskell DJ (2003). Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica. Nat Genet. 35(1):32-40. [PudMed:12910271]