SecReT4
Effector Protein ID: 33598792
T4SS name [ID]Ptl [387]
Gene symbolptxC
Locus tagBPP4308
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4639708..4640391 [+]
Producttoxin subunit 3
Effector typeProtein
DescriptonPtxC
T4CP requirementT4CP Indepedent
Target/EffectionA subunit of pertussis toxin (PT). PT is involved in the colonization of the respiratory tract and the establishment of infection of Bordetella pertussis causing whooping cough
UniProt IDQ7W2U6
KEGG IDbpa:BPP4308
PDB IDNA
Domain hit(s) vs Pfam Pertussis_S2S3 [PF02918], Evalue: 2e-62, Aligned region: 118..226
APT [PF03440], Evalue: 5.3e-37, Aligned region: 31..117
Protein Sequence: 227 a.a.     [Download]
>gi|33598792|ref|NP_886435.1| ptxC gene product [Bordetella parapertussis 12822]
MLINNKKLLHHILPILVLALLGMRTAQAVAPGIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQ
TYLRQITPGWSIYGLYDGTYLGQAYGGIIKDAPPGAGFIYRETFCITTMYKTGQPAADHYYSKVTATRLL
ASTNSRLCAVFVRDGQSVIGACASPYEGRYRDMYDVLRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQ
TYALTGISLCNPAASIC
-
Nucleotide Sequence: 684 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4639708-4640391 Bordetella parapertussis 12822 chromosome, complete genome
ATGCTGATCAACAACAAGAAGCTGCTTCATCACATTCTGCCCATCCTGGTGCTCGCCCTGCTGGGCATGC
GCACGGCCCAGGCCGTTGCGCCAGGCATCGTCATCCCGCCGAAGGCACTGTTCACCCAACAGGGCGGCGC
CTATGGACGCTGCCCGAACGGAACCCGCGCCTTGACCGTGGCCGAACTGCGCGGCAACGCCGAATTGCAG
ACGTATTTGCGCCAGATAACGCCCGGCTGGTCCATATACGGTCTCTATGACGGTACGTACCTGGGCCAGG
CGTACGGCGGCATCATCAAGGACGCGCCGCCAGGCGCGGGGTTCATTTATCGCGAAACTTTCTGCATCAC
GACCATGTACAAGACCGGGCAACCGGCTGCGGATCACTACTACAGCAAGGTCACGGCCACGCGCCTGCTC
GCCAGCACCAACAGCAGGCTGTGCGCGGTATTCGTCAGGGACGGGCAATCGGTCATCGGCGCCTGCGCCA
GCCCGTATGAAGGCAGGTACAGAGACATGTACGACGTGCTGCGGCGCCTGCTGTACATGATCTATATGTC
CGGCCTTGCCGTACGCGTCCACGTCAGCAAGGAAGAGCAGTATTACGACTACGAGGACGCCACATTCCAG
ACCTATGCCCTCACCGGCATTTCCCTCTGCAACCCGGCAGCGTCGATATGCTGA
 Primer design

Reference
(1) Parkhill J; Sebaihia M; Preston A; Murphy LD; Thomson N; Harris DE; Holden MT; Churcher CM; Bentley SD; Mungall KL; Cerdeno-Tarraga AM; Temple L; James K; Harris B; Quail MA; Achtman M; Atkin R; Baker S; Basham D; Bason N; Cherevach I; Chillingworth T; Collins M; Cronin A; Davis P; Doggett J; Feltwell T; Goble A; Hamlin N; Hauser H; Holroyd S; Jagels K; Leather S; Moule S; Norberczak H; O'Neil S; Ormond D; Price C; Rabbinowitsch E; Rutter S; Sanders M; Saunders D; Seeger K; Sharp S; Simmonds M; Skelton J; Squares R; Squares S; Stevens K; Unwin L; Whitehead S; Barrell BG; Maskell DJ (2003). Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica. Nat Genet. 35(1):32-40. [PudMed:12910271]