SecReT4
Effector Protein ID: 33603863
T4SS name [ID]Ptl [379]
Gene symbolptxA
Locus tagBB4890
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5198963..5199772 [+]
Producttoxin subunit 1
Effector typeProtein
DescriptonPtxA
T4CP requirementT4CP Indepedent
Target/EffectionA subunit of pertussis toxin (PT). PT is involved in the colonization of the respiratory tract and the establishment of infection of Bordetella pertussis causing whooping cough
UniProt IDQ7WDU8
KEGG IDbbr:BB4890
PDB IDNA
Domain hit(s) vs Pfam Pertussis_S1 [PF02917], Evalue: 1.4e-131, Aligned region: 36..268
Protein Sequence: 269 a.a.     [Download]
>gi|33603863|ref|NP_891423.1| ptxA gene product [Bordetella bronchiseptica RB50]
MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLEHL
TGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFE
YVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYPNARYVSQQTRANPN
PYTSRRSVASIVGTLVRMAPVTGACMARQAESPEAMAAWSERAGEAMVLVYYESIAYSF
-
Nucleotide Sequence: 810 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5198963-5199772 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGCGTTGCACTCGGGCAATTCGCCAAACCGCAAGAACAGGCTGGCTGACGTGGCTGGCGATTCTTGCCG
TCACGGCGCCCGTGACTTCGCCGGCATGGGCCGACGATCCTCCCGCCACCGTATACCGCTATGACTCCCG
CCCGCCGGAGGACGTTTTCCAGAACGGATTCACGGCGTGGGGAAACAACGACAATGTGCTCGAACATCTG
ACCGGACGTTCCTGCCAGGTCGGCAGCAGCAACAGCGCTTTCGTCTCCACCAGCAGCAGCCGGCGCTATA
CCGAGGTCTATCTCGAACATCGCATGCAGGAAGCGGTCGAGGCCGAACGCGCCGGCAGGGGCACCGGCCA
CTTCATCGGCTACATCTACGAAGTCCGCGCCGACAACAATTTCTACGGCGCCGCCAGCTCGTACTTCGAA
TACGTCGACACTTATGGCGACAATGCCGGCCGTATCCTCGCCGGCGCGCTGGCCACCTACCAGAGCGAAT
ATCTGGCACACCGGCGCATTCCGCCCGAAAACATCCGCAGGGTAACGCGGGTCTATCACAACGGCATCAC
CGGCGAGACCACGACCACGGAGTATCCCAACGCTCGCTACGTCAGCCAGCAGACTCGCGCCAATCCCAAC
CCCTACACATCGCGAAGGTCCGTAGCGTCGATCGTCGGCACATTGGTGCGCATGGCGCCGGTGACGGGCG
CTTGCATGGCGCGGCAGGCCGAAAGCCCCGAGGCCATGGCAGCCTGGTCCGAACGCGCCGGCGAGGCGAT
GGTTCTCGTGTACTACGAAAGCATCGCGTATTCGTTCTAG
 Primer design

Reference
(1) Parkhill J; Sebaihia M; Preston A; Murphy LD; Thomson N; Harris DE; Holden MT; Churcher CM; Bentley SD; Mungall KL; Cerdeno-Tarraga AM; Temple L; James K; Harris B; Quail MA; Achtman M; Atkin R; Baker S; Basham D; Bason N; Cherevach I; Chillingworth T; Collins M; Cronin A; Davis P; Doggett J; Feltwell T; Goble A; Hamlin N; Hauser H; Holroyd S; Jagels K; Leather S; Moule S; Norberczak H; O'Neil S; Ormond D; Price C; Rabbinowitsch E; Rutter S; Sanders M; Saunders D; Seeger K; Sharp S; Simmonds M; Skelton J; Squares R; Squares S; Stevens K; Unwin L; Whitehead S; Barrell BG; Maskell DJ (2003). Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica. Nat Genet. 35(1):32-40. [PudMed:12910271]