SecReT4
Effector Protein ID: 33603864
T4SS name [ID]Ptl [379]
Gene symbolptxB
Locus tagBB4891
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5199812..5200492 [+]
Producttoxin subunit 2
Effector typeProtein
DescriptonPtxB
T4CP requirementT4CP Indepedent
Target/EffectionA subunit of pertussis toxin (PT). PT is involved in the colonization of the respiratory tract and the establishment of infection of Bordetella pertussis causing whooping cough
UniProt IDQ7WDU7
KEGG IDbbr:BB4891
PDB IDNA
Domain hit(s) vs Pfam Pertussis_S2S3 [PF02918], Evalue: 3.3e-62, Aligned region: 117..225
APT [PF03440], Evalue: 1.2e-37, Aligned region: 30..116
Protein Sequence: 226 a.a.     [Download]
>gi|33603864|ref|NP_891424.1| ptxB gene product [Bordetella bronchiseptica RB50]
MPIDRKTLCHLLSVLPLALLGSHVARASTPGIVIPPQEQITQHGGPYGRCANKTRALTVAELRGSGDLQE
YLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHFYSNVTATRLLS
STNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFET
YALTGISICNPGSSLC
-
Nucleotide Sequence: 681 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5199812-5200492 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGCCGATCGACCGCAAGACGCTCTGCCATCTCCTGTCCGTTCTGCCGTTGGCCCTCCTCGGATCTCACG
TGGCGCGGGCCTCCACGCCAGGCATCGTCATTCCGCCGCAGGAACAGATTACCCAGCACGGCGGCCCCTA
TGGACGCTGCGCGAACAAGACCCGTGCCCTGACCGTGGCGGAATTGCGCGGCAGCGGCGATCTGCAGGAG
TACCTGCGTCATGTGACGCGCGGCTGGTCAATATTTGCGCTCTACGATGGCACCTATCTCGGCGGCGAAT
ATGGCGGCGTGATCAAGGACGGAACACCCGGCGGCGCATTCGACCTGAAAACGACGTTCTGCATCATGAC
CACGCGCAATACGGGTCAACCCGCAACGGATCACTTCTACAGCAACGTCACCGCCACTCGCCTGCTCTCC
AGCACCAACAGCAGGCTATGCGCGGTCTTCGTCAGAAGCGGGCAACCGGTCATTGGCGCCTGCACCAGCC
CGTATGACGGCAAGTACTGGAGCATGTACAGCCGGCTGCGGAAAATGCTTTACCTGATCTACGTGGCCGG
CATCTCCGTACGCGTCCATGTCAGCAAGGAAGAACAGTATTACGACTACGAAGACGCAACGTTCGAGACT
TACGCCCTTACCGGCATCTCCATCTGCAATCCGGGATCATCCTTATGCTGA
 Primer design

Reference
(1) Parkhill J; Sebaihia M; Preston A; Murphy LD; Thomson N; Harris DE; Holden MT; Churcher CM; Bentley SD; Mungall KL; Cerdeno-Tarraga AM; Temple L; James K; Harris B; Quail MA; Achtman M; Atkin R; Baker S; Basham D; Bason N; Cherevach I; Chillingworth T; Collins M; Cronin A; Davis P; Doggett J; Feltwell T; Goble A; Hamlin N; Hauser H; Holroyd S; Jagels K; Leather S; Moule S; Norberczak H; O'Neil S; Ormond D; Price C; Rabbinowitsch E; Rutter S; Sanders M; Saunders D; Seeger K; Sharp S; Simmonds M; Skelton J; Squares R; Squares S; Stevens K; Unwin L; Whitehead S; Barrell BG; Maskell DJ (2003). Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica. Nat Genet. 35(1):32-40. [PudMed:12910271]