SecReT4
Effector Protein ID: 340790644
T4SS name [ID]VirB [366]
Gene symbol-
Locus tagBPI_I1065
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015857] [Browse all T4SS(s) in this replicon]
Location [Strand]1014446..1019194 [-]
Producthypothetical protein
Effector typeProtein
DescriptonBPE043
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to BPE043. Function unknown
UniProt IDC9TVC6
KEGG IDbpp:BPI_I1065
PDB IDNA
Domain hit(s) vs Pfam Apolipoprotein [PF01442], Evalue: 3.6e-37, Aligned region: 351..554
Apolipoprotein [PF01442], Evalue: 3.6e-37, Aligned region: 559..751
Apolipoprotein [PF01442], Evalue: 3.6e-37, Aligned region: 881..1009
Apolipoprotein [PF01442], Evalue: 3.6e-37, Aligned region: 1017..1186
Apolipoprotein [PF01442], Evalue: 3.6e-37, Aligned region: 1234..1546
Protein Sequence: 1582 a.a.     [Download]
>gi|340790644|ref|YP_004756109.1| hypothetical protein BPI_I1065 [Brucella pinnipedialis B2/94]
MADKVFVTALNDPAVAVNEYEVGKEMASKSKAQKLDLEVEKALEQALDIDFGDDIDIDMDLGAFDEGFSI
DDLEEQISRAAEELVAEQQAKAAEPVGNEPVVKAASVITTASVIATPAAPPVPPVVKAASSAPAIAANTE
HKPANVVAEPVSAQETAAKPAAAVATATPVATPVRTPANDDSRSDKAIAAAPRRITEHSSKLYWTTTAIS
VLWAAGGVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVALPIAMFWGFAQLVKRAQEMQNAARSMTD
AALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELETLVQSEVNQLERAYSDNEVRIRSLV
SDLGNEREAVVSHAERVRSSISGAHEQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGG
AIADAIEKRTGDIGNRITTSGEAFANLLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVS
EFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNS
LGAMVDDIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAAR
TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSLEERTASLHNVIAGNQ
AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAESLGAGRDAFE
TALGEHVRTVEERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQ
RTTSLQNAIANSSAAISSAFEGQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAAST
LAAEAAKAGEALDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKT
SETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDTTAVTLEERT
RELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRSENAALVNALASRTAETI
AAVQQAKVGLSDNVSELIDRLAASNGELGKLIDAATRNLADIDGRLVDSTTSFVENTNRAAQMFQASTGL
IDSNLGTLRTLSDNTLSQIADIADRFDEHGKVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSE
GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGE
LKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV
RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQPAATPRSPSHV
VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMD
DFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTMLAHASGRLR
-
Nucleotide Sequence: 4749 bp     [Download]
>gi|340789630|ref|NC_015857.1|:c1019194-1014446 Brucella pinnipedialis B2/94 chromosome 1, complete sequence
ATGGCGGATAAAGTTTTTGTAACGGCTCTCAATGATCCGGCCGTCGCGGTAAATGAGTACGAGGTAGGCA
AAGAGATGGCTTCAAAATCCAAGGCACAGAAGCTCGACCTTGAGGTTGAAAAGGCGCTGGAACAGGCACT
GGATATCGATTTCGGAGACGATATTGATATCGATATGGACTTGGGTGCGTTTGACGAAGGCTTCTCGATT
GACGATCTGGAAGAGCAGATTTCCCGTGCCGCGGAAGAACTCGTCGCCGAACAGCAGGCGAAAGCCGCCG
AGCCTGTTGGAAACGAGCCGGTCGTCAAGGCCGCTTCGGTCATCACAACGGCTTCCGTGATTGCAACGCC
TGCTGCGCCTCCGGTGCCGCCTGTCGTCAAGGCGGCCTCCTCTGCTCCCGCTATAGCCGCCAATACCGAG
CACAAACCTGCCAATGTAGTTGCCGAACCCGTTTCAGCACAGGAGACCGCGGCCAAGCCTGCCGCTGCGG
TCGCCACTGCAACGCCGGTCGCCACGCCTGTTCGTACACCAGCAAATGACGATTCGCGCAGCGACAAGGC
CATCGCCGCCGCGCCGCGCCGCATCACCGAGCATTCCTCTAAGCTTTACTGGACCACGACCGCAATCAGC
GTGCTGTGGGCGGCTGGCGGCGTTGCTATCAGCAAGGCGATCAATCCGGAAGTCTTCTCCAGCCTGCAAG
CCACCAAAGATTTCTTCACCGCACCCGCCGGACTTGGTGTGGTTGCCGGTGTGGCGCTGCCGATCGCGAT
GTTCTGGGGCTTCGCACAACTCGTCAAGCGTGCTCAGGAAATGCAGAACGCTGCGCGCAGCATGACCGAT
GCCGCGCTCAAACTGCTTCAGCCGGAAGCTGTCGCGGGTGATCGCGTCTCCACGCTGGGCCAGGCCGTGC
GCCGCGAAGTTGCAGCCATGAACGAAGGCATCGAACGCACACTTGCGCGCGCGGTGGAGCTGGAAACGCT
CGTCCAATCCGAGGTCAACCAGCTTGAGCGCGCCTATAGCGACAATGAGGTGCGTATCCGCTCGCTCGTC
AGCGATCTTGGCAATGAGCGTGAAGCAGTTGTCAGCCATGCCGAGCGTGTTCGTTCGTCCATCTCTGGTG
CGCATGAACAGCTTAGGGAAGAATTATCAAGTGCATCCAATATCATACGCGACAATGTTCTGTCCGCGTC
TCAGCAGCTCAGCGCGCTCTTGGGCGGTTCTGGCGAGCGCCTCATCAGCAATATCAACGAAAGCGGCGGC
GCTATTGCCGATGCAATCGAGAAGCGCACCGGCGATATTGGAAATCGCATCACCACCTCCGGCGAAGCTT
TTGCCAATCTGCTCGATACCCGCATCGCAACGCTTGACGAACAGTCGCGCACGATCTCCGGGAAGTTGAC
GCAGGCTCTGGACGAGCGCACCACCGGCATTGCAAATGTGCTTGGCAGCGCGACCCAGACCATGGTGAGC
GAGTTCGACACGCGCCTTGCCAATCTGGAAAACACCCTTTCCGACCGTGGCCGCTCGTTGCTGGCAGAGT
TTGAGGCGCGCGCCCATGCGCTTGACAACAGCACCGAAAAGCTGAATGCGGCGCTGGAAACCCGTTCGCG
CCAGATCAACGAAAACCTCATTGCCCGCACCCGTGAAATCGCCGAAACCTTCTCGGGCGGCCGCAATTCG
CTGGGCGCGATGGTGGACGACATCAAGGTGAAGATCGGCGACGATCTGACCTCGATCAGCGAAAGCGTCG
GCAATGTTCTGATCGATAAGGCAGCAGCCTTCGAGGGCAAGCTGGCCGAAAGCCGCGATCTTCTGGCGGC
AACGCTGGAAGGCGAAACAGAGCGCGTTTCCTCGGTCATTCGCGGCCATGCGGATACGCTTGCCGCGCGC
ACCGGCGATATCCAGAACGCTATCGATGCAAGCGCCTCAGCGCTCAATGAAGTCACAGACAAGCACGCGG
CAATCTTGGCCGAGCGCACCAGTGCGCTGCAGCAGGCCATGTCCAGCAATGTTTCCCTGCTGGATGCGAG
CTTCGCAGACCATGCCCGTTCACTTGAAGAGCGCACTGCGTCCCTGCACAATGTCATTGCAGGAAATCAG
GCAATGCTGGCTCAGCTCATGGATGAGCGTGCGGCTGCAATGCGCGAGAATTTCAACGAAAATCGTGAAG
TGCTGGCCCGCACCTTCGATGAACGTATTGGCAGCCTTCAGTCGCTTATCGCGGAAAACCAGAGCGCCCT
TGAGCGTATTCTGGATGAGCGCGCGCGCAATATGGCGGAATCCCTCGGCGCTGGCCGCGATGCCTTTGAA
ACGGCACTGGGCGAGCATGTCCGCACGGTCGAGGAACGCACAAGCGGCTTGCAAGCCGTTCTGAACAACC
ACAATGATGCGCTGGCGCATGTTCTGGATGGACATGAGCAGACCATTGAAACGCGGGCCGCTGAAATCCG
CTCCACCCTGACGGACAGCACGGCTTCGCTCAGCCAGACCTTGCAGGATCATGGCGAGATTCTGGAGCAG
CGCACCACGAGCCTGCAAAACGCCATCGCCAACAGCAGCGCCGCCATCAGCAGCGCCTTTGAGGGCCAGA
CCGGCATTATCGAAGAACGCACCGAGACCATGGAAAAGGCTCTTTCCATCGGCGTGGACAATGTGCGCCG
CGCACTGGAACAAAGTGCAGGCGTGGTCGCCGGAAAGCTGCGTGAAAAGATCGGTGAAGCTGCCAGCACA
CTTGCCGCTGAGGCCGCCAAAGCCGGCGAAGCCCTCGACGGCTTTGGCGAAAGCTTCAGTGCTCGGCTCA
TCGATAATCTTTCCGGCACCGAAGCCCGCCTCGGCGAACGCGCGGATGCTATTGCCGGACGCCTTGGCGA
CATTGAAAGCCGCCTTACCGACGAGCTTGGGACCATTGAGGCACGCATTGCCGATACGGCCGCCAAAACA
AGCGAAACGCTTGCCAGCCACAGCGAATCCTTCTCGGCCAGCGTTGCCGACAATCTCGCTGGCACAGAAA
CACGTCTTGTCGAGCGTGCGGATGCGATCGCAACCCGTCTTGGCGATATCGGCTCGCGCATCACGATGGA
GCTCGGCTCCGTCGAGGCTCGCATTGCGCAGGTGACGGATACGACGGCGGTTACGCTGGAAGAACGCACC
CGTGAGCTCAATGCCGTCCTCGCCGCTCGCTCGCAGGAAATCACCAAAATCCTCAACGATACGGCCGAAC
CGCTGGTTCAGCGCCTTGCCGATAGTGGCCGTGGCCTTGCCCAGCAGCTTGAAGAAGCAACCCATGCAGC
AACTGATCGCCTGCGTTCGGAAAATGCGGCGCTCGTCAATGCGCTGGCAAGCCGCACGGCGGAAACCATC
GCTGCGGTCCAGCAGGCAAAGGTCGGGCTTTCCGACAATGTCAGCGAACTCATTGACCGCCTCGCCGCTT
CCAATGGTGAGCTTGGCAAGCTGATTGATGCCGCCACGCGCAACCTTGCCGATATCGATGGGCGTCTGGT
GGACTCTACGACGAGCTTTGTGGAAAACACGAACCGCGCGGCGCAGATGTTCCAGGCTTCAACTGGCCTC
ATCGACAGCAATCTCGGTACGCTTCGTACGCTATCCGACAATACCTTGTCGCAAATCGCCGATATTGCCG
ACCGCTTCGATGAACATGGCAAGGTTCTGTCTTCGGCATCCGATATGATCAATTCCGCACAGAACGGCCT
CGTCAGCACACTTGACGAGCGTCATCAGGCGCTCGACAAGCTGGCTTCCGGTCTGGTGGAAAAATCGGAA
GGCGTCGAAAAGCTCATGCAATCCTTCGAGGCTCTGGTTGCCTCGGCCTTCCAGCGCGCCGAAGGCCAGA
CCCGCGTTTCGGCGGAAAAGATGCGCGAGAGCGTTTCGGATATCGTCGAACAGGCCGCACAGAAGTTCTC
GGCAGCGACCGACGAAATTCGCCGCACGGCAAGCGAAATCCGCGCCGAACTCGATACAACGCGCGGCGAA
CTGAAGCGTGGCGTTCTCGACATGCCTGCCGAAGCGAAGGAAACGACGACCGCCATGCGCAAGGCCGTGA
GCGAGCAGATCAACGCGCTCAAGGAACTTGCTGAAATTGTCAACAAGTCGGGCCGTCTGGTTGATGTGGG
TGAAGGCCGTGCCGACCGCCCTGTGTCGCGCCCCGCAGCATCTCGCCCTGCTCCGGTTCAAGCTCCTGTT
CGGGCACCGATCGCGCCTCTGGCACAGACAGATGTTGCAGTCCGGTCGCGTCCGGTGGAAGCGCCGAACC
AAAAGCCTGCTCCAGCGGCATCTGCGGAAAAGCCGCGCGGTTGGGTTTCCGATCTTCTTGCCCGCGCCTC
ACGTGAGGAAGAAGAAGCCGCGCAGCCCAAGGTGCAGCCGGCCGCAACGCCGCGTTCTCCGAGCCATGTG
GTTGAATCGCTCAACTCGCTTTCCGTCGATATCGCCCGTGCTATCGACCACGAAGCTTCGGTTGAGCTTT
GGGACCGTTATCGCCGCGGTGAGCGCAATGTTTTCACCCGCCGTCTCTATACGCTGAAAGGTCAGCAGAC
CTTTGACGATATCAAGCGCAAGTATCAGACCGATGGTGAATTCCGCCGCGCCGTAGATCGTTACATGGAC
GATTTCCAGCGTCTTCTCGAAGACGTTGCCCGCAATGACCGCGATAATATGGTGACGCAGACTTACCTGA
CATCCGACACAGGCAAGGTTTACACCATGCTCGCCCATGCAAGCGGACGCCTTCGGTAG
 Primer design