SecReT4
Effector Protein ID: 340790657
T4SS name [ID]VirB [366]
Gene symbol-
Locus tagBPI_I1079
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015857] [Browse all T4SS(s) in this replicon]
Location [Strand]1028232..1029488 [-]
Productproline-rich extensin
Effector typeProtein
DescriptonVceC
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to VceC. Function unknown
UniProt IDC9TVD9
KEGG IDbpp:BPI_I1079
PDB IDNA
Domain hit(s) vs Pfam FliO [PF04347], Evalue: 1.3e-07, Aligned region: 37..94
Protein Sequence: 418 a.a.     [Download]
>gi|340790657|ref|YP_004756122.1| proline-rich extensin [Brucella pinnipedialis B2/94]
MKEWLSGIIGESAANIVGFVLIFAIILGGIFVVLGIIRRFSGGTFVSSGRMRQPRLSVMDAAAVDSRRKL
VLIRRDDVEHLLLIGGPTDVVVEQNIVLESRAGTHAPGTHALGTHAQSSRIEPEHIERFRQHEVLANEKT
ERPALSVQSQPGDEREETIQLSSAIAAPVYRKPEPPKAENVRPAPSEPAPMRAPQPPVTPPPAAPRPEAP
ASQVSEPHPRPASNYPSQPRTVLPPRPAPSAAPNSVRAHPAYPLSQVSRGVVSSTSNIQAATVASAATAN
LGSIVPERESAAPAKPAAPAPNQPERSERPERPERPQQRIEPVVPFVAQEVRQPESADDDLDDLGGTLHD
AIMADLGSNAGKDENMEELDTASLEDELLSSLDISPTDEQPEDAKAEETIEDEMEKLLGELTKGETRN
-
Nucleotide Sequence: 1257 bp     [Download]
>gi|340789630|ref|NC_015857.1|:c1029488-1028232 Brucella pinnipedialis B2/94 chromosome 1, complete sequence
ATGAAGGAATGGCTCAGCGGCATCATCGGTGAAAGCGCGGCTAATATTGTCGGCTTTGTGCTTATATTTG
CAATCATCCTTGGCGGAATTTTTGTTGTTCTCGGCATCATTCGCCGTTTCAGCGGCGGCACATTTGTATC
CAGCGGGCGCATGCGCCAGCCCCGCCTTTCGGTGATGGATGCCGCCGCGGTAGACAGCCGGCGCAAGCTG
GTTCTGATCCGCCGCGACGATGTGGAACATCTGCTCCTGATCGGTGGCCCGACCGATGTGGTTGTCGAAC
AGAATATCGTTCTGGAATCGCGCGCTGGCACCCATGCCCCTGGAACTCATGCCCTTGGTACCCACGCACA
GAGCTCGCGTATCGAACCGGAACATATTGAACGCTTCCGCCAGCACGAAGTGCTTGCCAATGAGAAGACG
GAACGGCCTGCCCTTTCCGTCCAGTCCCAGCCCGGAGACGAACGCGAGGAAACTATTCAGCTAAGCTCGG
CCATCGCGGCGCCCGTCTATCGCAAGCCGGAGCCGCCGAAGGCTGAGAACGTCCGGCCCGCGCCCTCCGA
ACCCGCACCAATGCGGGCACCGCAGCCTCCCGTGACGCCACCGCCAGCCGCGCCGCGCCCTGAAGCGCCT
GCGTCGCAGGTTTCCGAGCCGCATCCGCGCCCAGCTTCAAATTACCCGTCACAGCCGCGCACGGTTCTTC
CCCCGCGCCCCGCGCCATCGGCTGCCCCAAACAGCGTTCGCGCGCATCCAGCCTATCCGCTGAGCCAGGT
TTCGCGCGGCGTGGTAAGTTCCACATCAAATATCCAGGCAGCCACGGTTGCATCGGCCGCGACAGCAAAT
CTGGGCAGCATTGTGCCCGAACGCGAATCTGCCGCTCCGGCAAAACCCGCAGCGCCCGCGCCGAATCAGC
CGGAACGTTCAGAGCGTCCAGAACGCCCGGAACGCCCACAACAACGCATCGAGCCGGTTGTTCCCTTTGT
CGCCCAGGAAGTCAGGCAGCCCGAAAGCGCAGATGACGATCTGGATGACCTTGGCGGCACATTGCATGAT
GCCATTATGGCCGATCTTGGCAGCAATGCCGGTAAAGATGAAAATATGGAGGAGTTGGACACGGCTTCGC
TGGAAGACGAACTACTCAGCTCGCTTGATATTTCACCTACCGATGAACAGCCGGAAGATGCCAAGGCCGA
AGAAACCATCGAAGACGAAATGGAAAAGCTGCTTGGCGAGTTGACCAAGGGAGAAACCCGCAATTAG
 Primer design