SecReT4
Effector Protein ID: 340790872
T4SS name [ID]VirB [366]
Gene symbol-
Locus tagBPI_I1305
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015857] [Browse all T4SS(s) in this replicon]
Location [Strand]1249921..1250682 [-]
Productrhomboid family protein
Effector typeProtein
DescriptonBPE275
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to BPE275. Function unknown
UniProt IDF9YI56
KEGG IDbpp:BPI_I1305
PDB IDNA
Domain hit(s) vs Pfam Rhomboid [PF01694], Evalue: 2.1e-25, Aligned region: 84..240
Protein Sequence: 253 a.a.     [Download]
>gi|340790872|ref|YP_004756337.1| rhomboid family protein [Brucella pinnipedialis B2/94]
MLPKDKREQHFMSIPQPEMRGTGGREPIFNIPGVVIALIGLCVAVYVYQNYILSERQDFEFMMNFALIPA
RFSMASGFVDPAVIFTFISYSFMHGSFAHIAVNMIWLAAFGSPLAGRIGAVRMILFWVFTSVVAGLTHYA
LHPESLSPLVGASGAISGMMGAAARYGFRRVGYGRRSEFAGPVLPIGLTLTLKPVLIFVGVWFLINIVTG
LYSTGGADFSSIAWEAHIGGFIAGFFGIPLMDRPRSYDAVLRR
-
Nucleotide Sequence: 762 bp     [Download]
>gi|340789630|ref|NC_015857.1|:c1250682-1249921 Brucella pinnipedialis B2/94 chromosome 1, complete sequence
ATGCTTCCGAAAGACAAGAGAGAGCAGCACTTCATGAGCATTCCCCAGCCGGAAATGCGCGGCACAGGCG
GCCGCGAGCCGATCTTCAATATTCCGGGTGTCGTGATTGCTCTGATCGGGTTGTGTGTCGCGGTCTATGT
CTATCAGAATTATATTCTGAGCGAGCGGCAGGATTTTGAGTTCATGATGAACTTTGCGCTGATCCCGGCG
CGCTTTTCGATGGCGAGCGGCTTTGTTGATCCGGCGGTGATTTTTACGTTTATCAGCTATTCCTTCATGC
ATGGCAGTTTTGCGCATATTGCCGTCAATATGATCTGGCTTGCCGCATTCGGCTCGCCGCTGGCCGGGCG
AATCGGCGCGGTCCGGATGATCCTATTCTGGGTTTTCACGTCGGTCGTCGCGGGGCTTACGCATTACGCA
CTCCATCCCGAAAGCCTTTCGCCGCTGGTGGGTGCGTCGGGCGCGATTTCGGGCATGATGGGAGCTGCCG
CCCGCTATGGTTTTCGGCGTGTCGGCTATGGCCGGCGCTCGGAATTTGCCGGGCCGGTGCTTCCCATCGG
GCTGACGCTGACGCTCAAGCCCGTCCTCATTTTTGTCGGCGTCTGGTTTCTCATCAATATCGTCACCGGC
CTTTATTCCACTGGCGGCGCCGACTTTTCCAGCATTGCCTGGGAGGCGCATATAGGCGGCTTCATTGCCG
GGTTTTTCGGGATTCCACTGATGGACCGCCCGCGCAGCTATGATGCCGTTTTGAGGCGATAG
 Primer design