SecReT4
Effector Protein ID: 340790875
T4SS name [ID]VirB [366]
Gene symbol-
Locus tagBPI_I1308
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015857] [Browse all T4SS(s) in this replicon]
Location [Strand]1252610..1253137 [-]
Productferripyochelin-binding protein
Effector typeProtein
DescriptonRicA
T4CP requirementT4CP Indepedent
Target/EffectionPredicted effector. Homologous to RicA. RicA was demonstrated to interact with human small GTPase Rab2 involved in trafficking
UniProt IDC9TWH3
KEGG IDbpp:BPI_I1308
PDB IDNA
Domain hit(s) vs Pfam Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 17..47
Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 75..105
Hexapep [PF00132], Evalue: 2.6e-19, Aligned region: 90..124
Protein Sequence: 175 a.a.     [Download]
>gi|340790875|ref|YP_004756340.1| ferripyochelin-binding protein [Brucella pinnipedialis B2/94]
MPIYAYNGHKPQFADRESNWIAPDATLIGKVVVGENAGFWFGAVLRGDNEPITIGADTNVQEQTIMHTDI
GFPLTIGAGCTIGHRAILHGCTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKEGMEIPDNSLVVGSPA
RVLRQLDDAAVEKLRASAKHYVERGHSFMRGMEPA
-
Nucleotide Sequence: 528 bp     [Download]
>gi|340789630|ref|NC_015857.1|:c1253137-1252610 Brucella pinnipedialis B2/94 chromosome 1, complete sequence
ATGCCGATCTATGCATATAACGGGCACAAGCCGCAGTTTGCGGACCGCGAGAGCAACTGGATTGCACCGG
ATGCGACGCTGATCGGCAAGGTGGTCGTGGGCGAGAATGCGGGTTTCTGGTTCGGCGCGGTGTTGCGCGG
CGATAATGAGCCAATCACTATCGGTGCCGATACCAATGTGCAGGAACAGACGATCATGCACACCGATATC
GGCTTTCCGCTGACCATCGGTGCGGGCTGCACTATCGGGCACCGTGCGATTCTCCATGGCTGCACGATTG
GCGAGAATACTCTTATCGGCATGGGCGCGATTGTGCTCAATGGCGCGAAGGTCGGCAAGAATTGCCTTAT
CGGGGCGGGAACATTGGTGAAAGAAGGGATGGAAATCCCTGATAATTCGCTTGTTGTCGGCTCTCCCGCG
CGTGTCCTGCGCCAGCTTGACGATGCTGCCGTTGAAAAGCTGCGGGCCTCTGCAAAGCATTATGTGGAGA
GGGGACATTCCTTCATGCGCGGCATGGAGCCTGCCTGA
 Primer design